DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and dhs-6

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001021972.1 Gene:dhs-6 / 3565470 WormBaseID:WBGene00000970 Length:418 Species:Caenorhabditis elegans


Alignment Length:265 Identity:67/265 - (25%)
Similarity:121/265 - (45%) Gaps:32/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQK-------NVDSALAELRKLNLNVHGL 125
            :..|:..::|.::.|||..||.:||:|||.:|::::...       .:.||..|:.|  .....|
 Worm     6 KFVGRTVLITGASRGIGKEIALKLAKDGANIVVAAKTATAHPKLPGTIYSAAEEIEK--AGGKAL 68

  Fly   126 KCHVSEPEDR--KQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIFDVNVKSSYLLA 188
            .|.|...::.  |...||.:.|||.::||::||:. .::......:.|.:|.:..:|.:.::|:.
 Worm    69 PCIVDVRDEASVKASVEEAVKKFGGIDILINNASA-ISLTDTENTEMKRYDLMHSINTRGTFLMT 132

  Fly   189 KEALPLLRQQKNSSIVFVSSIAGYDA--FELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAP 251
            |..||.|:..||..::.:|.....:.  |....||:::|..:........::..|.||.||.|.|
 Worm   133 KTCLPYLKSGKNPHVLNISPPLLMETRWFANHVAYTMAKYGMSMCVLGQHEEFRPHGIAVNALWP 197

  Fly   252 GVIRTKFSKALYE--NESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITG-----ESIVA 309
               .|....|..|  ::...||...|..:        ||.....::|:::...||     |.|:.
 Worm   198 ---LTAIWTAAMEMLSDKGGEAGSRKPSI--------MADAAYAVLSKNSKDFTGNFCIDEDILK 251

  Fly   310 GGGMT 314
            ..|:|
 Worm   252 AEGVT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 67/265 (25%)
fabG 67..316 CDD:235975 67/265 (25%)
dhs-6NP_001021972.1 PRK08278 9..275 CDD:181349 67/262 (26%)
SCP2 319..411 CDD:376720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.