DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and hsdl2

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_955893.1 Gene:hsdl2 / 322347 ZFINID:ZDB-GENE-030131-1066 Length:415 Species:Danio rerio


Alignment Length:262 Identity:69/262 - (26%)
Similarity:119/262 - (45%) Gaps:45/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQK-------NVDSALAELRKLNLNVHGL 125
            :|||....:|.::.|||.|||.:.|:|||.|||:::...       .:.:|.||:..  .....|
Zfish     7 KLAGCTIFITGASRGIGKAIALKAAQDGANVVIAAKTADPHPKLPGTIYTAAAEIEA--AGGKAL 69

  Fly   126 KCHVSEPEDRKQL---FEETISKFGKLNILVSNA-ATNPAVGGVLECDEKVWDKIFDVNVKSSYL 186
            .| :.:..|.||:   .|:.:.|||.::|||:|| |.|  :.|.|:...|..|.:..:|::.:||
Zfish    70 PC-IVDVRDEKQINDAVEQAVEKFGGIDILVNNASAIN--LTGTLQTPMKKADLMLGINLRGTYL 131

  Fly   187 LAKEALPLLRQQKNSSIVFVSSIAGYDA--FELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCL 249
            .:|..:|.|.:.||..|:.:|.....:.  |:...||:::|..:.......|::.. ..|.||.|
Zfish   132 TSKLCIPHLLKSKNPHILNLSPPLNLNPIWFKNHTAYTIAKYGMSMCVLGMAEEFR-GSIAVNAL 195

  Fly   250 APGVIRTKFSKALYENESANEAALSKIPMGRLGTSE--------EMAGVVSFLVSEDAGYITGES 306
            .|                  :.|:....|..||.||        |:....::.:.:.....||:.
Zfish   196 WP------------------KTAIQTAAMDMLGGSEVGKQCRKVEIMADAAYAIFKQPTSFTGQF 242

  Fly   307 IV 308
            ::
Zfish   243 VI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 69/262 (26%)
fabG 67..316 CDD:235975 69/262 (26%)
hsdl2NP_955893.1 HSDL2_SDR_c 8..248 CDD:187663 69/261 (26%)
adh_short 12..210 CDD:278532 59/221 (27%)
SCP2 311..408 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.