DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and antdh

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster


Alignment Length:264 Identity:71/264 - (26%)
Similarity:120/264 - (45%) Gaps:30/264 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 MKRLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVHG----LK 126
            |:|...:|||||.::.|||.||||.|...|..||..:|:   ||......|:|.....|    |.
  Fly     1 MERWQNRVAVVTGASSGIGSAIAKDLVLAGMTVVGLARR---VDRVKELQRELPAEKRGKLFALY 62

  Fly   127 CHVSEPEDRKQLFEETISKFGKLNILVSNAAT-NPAVGGVLECDEKVWDKIFDVNVKSSYLLAKE 190
            |.|.......:.|:..|.|.|.:::||:||.| .|  |.:::.:..|..::...|:....|..:.
  Fly    63 CDVGNESSVNEAFDWIIQKLGAIDVLVNNAGTLQP--GYLVDMNPAVMQQVLQTNIMGIVLCTQR 125

  Fly   191 ALPLLRQQK-NSSIVFVSSIAGYDAFEL-------LGAYSVSKTALIGLTKAAAKDLAPEG--IR 245
            |:..:|::| :..:|.::||.|:.....       :..|..||.|:..|.:...::....|  |:
  Fly   126 AVRSMRERKFDGHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGTRIK 190

  Fly   246 VNCLAPGVIRTKFSKALYENESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAG 310
            :..::|||:.|:...     :|..||.     ..|:..||::|..|.:.::........|.|:..
  Fly   191 ITSVSPGVVDTEIVP-----DSIREAI-----KDRMLHSEDIAQGVLYAIATPPHVQVHELIIKP 245

  Fly   311 GGMT 314
            .|.|
  Fly   246 LGET 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 70/263 (27%)
fabG 67..316 CDD:235975 70/263 (27%)
antdhNP_572695.2 YdfG 1..250 CDD:226674 71/264 (27%)
NADB_Rossmann 1..245 CDD:304358 69/258 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435170
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.