DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and CG31548

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster


Alignment Length:263 Identity:81/263 - (30%)
Similarity:141/263 - (53%) Gaps:31/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVHGLKC-HVSEPE 133
            ||||.::|.::.|||.|.|.:.|:.||.:.::.|..:|:....||..|::.:...|.. .:::..
  Fly     4 AGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAKEA 68

  Fly   134 DRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDE------KVWDKIFDVNVKSSYLLAKEAL 192
            |.::::.||:.::|||::||:||       |::|...      :.:|::.:.|:::.|.|...|.
  Fly    69 DTQRIWSETLQQYGKLDVLVNNA-------GIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLAT 126

  Fly   193 PLLRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRTK 257
            |.|.:.| .:||.|||:.|..:|..:.||::||..:...|:..|.:||.:|:||||:.|||..|.
  Fly   127 PELVKTK-GNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTN 190

  Fly   258 FS----------KALYENESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGG 312
            ..          |...|:.....|      :||.|..:|:|..::||.|::|.:.||.|:...||
  Fly   191 LHARGGMDAETYKKFLEHSKTTHA------LGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGG 249

  Fly   313 MTA 315
            ..|
  Fly   250 RHA 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 81/263 (31%)
fabG 67..316 CDD:235975 81/263 (31%)
CG31548NP_730974.1 fabG 1..250 CDD:235975 79/259 (31%)
NADB_Rossmann 3..253 CDD:304358 81/263 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435188
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.