DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and DHRS4L2

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_932349.2 Gene:DHRS4L2 / 317749 HGNCID:19731 Length:232 Species:Homo sapiens


Alignment Length:197 Identity:98/197 - (49%)
Similarity:128/197 - (64%) Gaps:0/197 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RLSSSSQSSTAGTMKRLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRK 117
            |.|....||.......|..|||:|||||||||||||:|||:|.|.||:|||||:|||.|:|.|:.
Human    14 RKSVRMASSRMTRRDPLTNKVALVTASTDGIGFAIARRLAQDRAHVVVSSRKQQNVDQAVATLQG 78

  Fly   118 LNLNVHGLKCHVSEPEDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIFDVNVK 182
            ..|:|.|..|||.:.|||::|....:...|.::|||||||.||..|.:::..|:||||..|:|||
Human    79 EGLSVTGTVCHVGKAEDRERLVAMAVKLHGGIDILVSNAAVNPFFGSLMDVTEEVWDKTLDINVK 143

  Fly   183 SSYLLAKEALPLLRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVN 247
            :..|:.|..:|.:.::...|:|.|||||.:........|:||||||:||....|.:|||..||||
Human   144 APALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLNNTLAIELAPRNIRVN 208

  Fly   248 CL 249
            ||
Human   209 CL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 94/183 (51%)
fabG 67..316 CDD:235975 94/183 (51%)
DHRS4L2NP_932349.2 NADB_Rossmann 24..>210 CDD:304358 92/185 (50%)
adh_short 33..210 CDD:278532 91/176 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 238 1.000 Domainoid score I2300
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 260 1.000 Inparanoid score I3114
Isobase 1 0.950 - 0.772507 Normalized mean entropy S1637
OMA 1 1.010 - - QHG57783
OrthoDB 1 1.010 - - D1194344at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm40894
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43943
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X181
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.