DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and sni

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster


Alignment Length:204 Identity:52/204 - (25%)
Similarity:87/204 - (42%) Gaps:26/204 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 VVTASTDGIGFAIAKRLAE--DGAAVVISSRKQKNVDSALAELRKLNLNVHGLKCHVS--EPEDR 135
            ::|....|:|..:.|.|..  .....:.::.:.:.....|.:|.|.:.|:|.|:..:.  :..|:
  Fly     5 LITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELEDLAKNHSNIHILEIDLRNFDAYDK 69

  Fly   136 KQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIFDVNVKSSYLLAKEALPLLRQ--Q 198
            .....|.::|...||:|.:||...|....:.....:........|.....:|||..||||::  :
  Fly    70 LVADIEGVTKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACLPLLKKAAK 134

  Fly   199 KNSS---------IVFVSSIAGYDAFELLG-------AYSVSKTALIGLTKAAAKDLAPEGIRVN 247
            .|.|         |:.:|||.|    .:.|       ||..||:||...||:.:.||.|:.|...
  Fly   135 ANESQPMGVGRAAIINMSSILG----SIQGNTDGGMYAYRTSKSALNAATKSLSVDLYPQRIMCV 195

  Fly   248 CLAPGVIRT 256
            .|.||.::|
  Fly   196 SLHPGWVKT 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 52/204 (25%)
fabG 67..316 CDD:235975 52/204 (25%)
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 52/204 (25%)
adh_short 4..209 CDD:278532 52/204 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435196
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.