DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and Hsdl2

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001020868.1 Gene:Hsdl2 / 313200 RGDID:1305387 Length:524 Species:Rattus norvegicus


Alignment Length:267 Identity:73/267 - (27%)
Similarity:117/267 - (43%) Gaps:55/267 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVH-----GLKC 127
            :|||....:|.::.|||.|||.:.|:|||.:||:::..:.....|..:......:.     .|.|
  Rat     7 KLAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTTQRHPKLLGTIYTAAEEIEAAGGKALPC 71

  Fly   128 HVSEPEDRKQL---FEETISKFGKLNILVSNAA----TNPAVGGVLECDEKVWDKIFDVNVKSSY 185
             |.:..|.:|:   .|:.:.:||.::|||:||:    ||     .||...|..|.:..||.:.:|
  Rat    72 -VVDVRDEQQINSAVEKAVERFGGIDILVNNASAISLTN-----TLETPTKRVDLMMSVNTRGTY 130

  Fly   186 LLAKEALPLLRQQKNSSIVFVSSIAGYDA--FELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNC 248
            |.:|..:|.|::.|.:.|:.:|.....:.  |:...||:::|..:.......|::...| |.||.
  Rat   131 LTSKACIPFLKKSKVAHILNLSPPLNLNPMWFKQHCAYTIAKYGMSMCVLGMAEEFRGE-IAVNA 194

  Fly   249 LAPGVIRTKFSKALYENESANEAALSKIPMGRLGTSEEMAGVVSFL----VSEDAGY-------- 301
            |.|   ||               |:....|..||.    |||.|..    :..||.|        
  Rat   195 LWP---RT---------------AIHTAAMDMLGG----AGVESQCRKVDIIADAAYSIFKRPKS 237

  Fly   302 ITGESIV 308
            .||..|:
  Rat   238 FTGNFII 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 73/267 (27%)
fabG 67..316 CDD:235975 73/267 (27%)
Hsdl2NP_001020868.1 HSDL2_SDR_c 8..248 CDD:187663 73/266 (27%)
adh_short 12..197 CDD:278532 53/191 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..410
SCP2 424..517 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.