DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and CG3699

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster


Alignment Length:251 Identity:84/251 - (33%)
Similarity:138/251 - (54%) Gaps:16/251 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVHGLKCHV---S 130
            |:.||.:||.::.|||.|||:.||.:||.:.:..|...|:::....|:       |.:..:   .
  Fly     3 LSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSLK-------GTQAEIVVAD 60

  Fly   131 EPEDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIFDVNVKSSYLLAKEALPLL 195
            ..:|...:.::|::|||::::||:||.. ...||:::.|.:.:|.:.:.|::...||.|..||.|
  Fly    61 VTKDADAIVQQTLAKFGRIDVLVNNAGI-LGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHL 124

  Fly   196 RQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRTKFSK 260
            .:.| .::|.|||.||...|....:|.|||.||...||..|.::||:|:|||.:.||.:.|...:
  Fly   125 LKTK-GAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHR 188

  Fly   261 AL-YENESAN---EAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGG 312
            .: ..:|..|   :.|::..||||:|...|:|..|:||.|..|.:.||......||
  Fly   189 NIGIVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 84/251 (33%)
fabG 67..316 CDD:235975 84/251 (33%)
CG3699NP_569875.2 fabG 1..244 CDD:235546 82/249 (33%)
NADB_Rossmann 3..248 CDD:304358 84/251 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435115
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm46682
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.