DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and CG13377

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001259089.1 Gene:CG13377 / 30972 FlyBaseID:FBgn0261446 Length:330 Species:Drosophila melanogaster


Alignment Length:224 Identity:46/224 - (20%)
Similarity:90/224 - (40%) Gaps:37/224 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 CHKRLSSSSQSSTAGTMKRLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAE 114
            |..|..|:|.::.:.     ..:|.::|::...:|..:...||..|..|....::.:  ||..| 
  Fly    29 CKVREDSASANADSH-----PSRVVLITSADTALGLQLCTHLANKGYRVFAGMKEAQ--DSLPA- 85

  Fly   115 LRKLNLNVHGLKCHVSEP--------------EDRKQLFEETISKFGKLN------ILVSNAATN 159
              ||......::.:..||              ||  .|.|.|:.....||      ..|.|.:.:
  Fly    86 --KLLCGWMKIREYSEEPIAGTIIPMRLDVTRED--VLREATVIIGANLNADERGIAAVINTSGS 146

  Fly   160 PAVGGVLECDEKVWDKIFDVNVKSSYLLAKEALPLLRQQKNSSIVFVSSIAG----YDAFELLGA 220
            ...|.|...:.:.|:.:...|:..:..:||..:..||..: ..::::..::|    .:..:.|.|
  Fly   147 VFRGQVESQNVQQWEHMLRTNILGTLRVAKAFVCFLRPTR-GRLLYLGGVSGGGNARNEGDGLVA 210

  Fly   221 YSVSKTALIGLTKAAAKDLAPEGIRVNCL 249
            ::.|:.|:....:...|:|.|.|:.|..|
  Fly   211 FNASRVAVDKCAEELRKELHPYGVSVVAL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 42/207 (20%)
fabG 67..316 CDD:235975 42/207 (20%)
CG13377NP_001259089.1 adh_short 46..246 CDD:278532 42/202 (21%)
NADB_Rossmann 46..>237 CDD:304358 40/198 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435133
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.