DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and Cbr3

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001100580.1 Gene:Cbr3 / 304078 RGDID:1309728 Length:277 Species:Rattus norvegicus


Alignment Length:240 Identity:56/240 - (23%)
Similarity:102/240 - (42%) Gaps:59/240 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 KVAVVTASTDGIGFAIAKRLAED-GAAVVISSRKQKNVDSALAELRKLNLNVHGLKCHVSEPEDR 135
            :||:||.:..||||||.:.|... ...||:::|.:....:|:.:|:...|:....:..:..|:..
  Rat     6 RVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAAVKQLQAEGLSPRFHQLDIDNPQSI 70

  Fly   136 KQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKV-WDKIFDVNVKSSYLLAK----EALPLL 195
            :.|.:....::|.||:||:||      |.....|:.. :|...:|.:|:::...:    |.||::
  Rat    71 RALRDFLRKEYGGLNVLVNNA------GIAFRMDDPTPFDVQAEVTLKTNFFATRNVCTELLPIM 129

  Fly   196 RQQKNSSIVFVSSIAGYDAFE----------------------LL-------------------G 219
            :  .:..:|.|||:.|..|.|                      |:                   .
  Rat   130 K--PHGRVVNVSSLQGLKALENCSEDLQERFRCDTLTEGDLVDLMKKFVEDTKNEVHEREGWPDS 192

  Fly   220 AYSVSKTALIGLTKAAAKDL----APEGIRVNCLAPGVIRTKFSK 260
            ||.|||..:..||:..|:.|    ..:.|.:|...||.::|..::
  Rat   193 AYGVSKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTDMAR 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 56/240 (23%)
fabG 67..316 CDD:235975 56/240 (23%)
Cbr3NP_001100580.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 56/240 (23%)
adh_short 6..241 CDD:278532 56/240 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.