DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10672 and RGD1564324

DIOPT Version :9

Sequence 1:	NP_647946.1	Gene:	CG10672 / 38598	FlyBaseID:	FBgn0035588	Length:	317	Species:	Drosophila melanogaster
Sequence 2:	NP_001099505.1	Gene:	RGD1564324 / 290217	RGDID:	1564324	Length:	107	Species:	Rattus norvegicus

Alignment Length:	64	Identity:	20/64 - (31%)
Similarity:	28/64 - (43%)	Gaps:	4/64 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   116 RKLNLNVHGLKC----HVSEPEDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDK 175
            ::|....|...|    ||.:.||.:....:.:...|.::.||...|.|..||..|...|.||||
  Rat    42 QRLQTADHAGTCSTVWHVGKAEDWQGPGAKALGYLGGVDFLVCITAVNLLVGSTLGASEPVWDK 105

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10672	NP_647946.1	NADB_Rossmann	67..317	CDD:304358	20/64 (31%)
CG10672	NP_647946.1	fabG	67..316	CDD:235975	20/64 (31%)
RGD1564324	NP_001099505.1	NADB_Rossmann	<55..>105	CDD:304358	15/49 (31%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0725
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900