DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and Decr2

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_036063.1 Gene:Decr2 / 26378 MGIID:1347059 Length:292 Species:Mus musculus


Alignment Length:274 Identity:74/274 - (27%)
Similarity:115/274 - (41%) Gaps:59/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVHGLKC-----H 128
            |..|||.:|....||||.||:.....|...||..|..:.|.:|..:|    :...|.:|     .
Mouse    26 LQDKVAFITGGGSGIGFRIAEIFMRHGCHTVIVGRSLQKVTTAAKKL----VAATGKRCLPLSMD 86

  Fly   129 VSEPEDRKQLFEETISKFGKLNILVSNAATN---PAVG---------------GVLECDEKVWDK 175
            |..|.:.....::.:.:|||:|||::.||.|   ||..               |.......::.|
Mouse    87 VRVPPEVMTAVDQALQEFGKINILINCAAGNFLCPASALSFNAFKTVVDIDTIGTFNVSSVLYKK 151

  Fly   176 IFD------VNVKSSYLLAKEALPLLRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKA 234
            .|.      ||:.::..:..:.|.|              .||           .:|.|:..:|:.
Mouse   152 FFRDHGGVIVNITATLSMRGQVLQL--------------HAG-----------AAKAAVDAMTRH 191

  Fly   235 AAKDLAPEGIRVNCLAPGVIR-TKFSKALYENESANEAALSKIPMGRLGTSEEMAGVVSFLVSED 298
            .|.:..|:.||||.||||.|. |:..:.|..:.::::......|:.||||..|:|..|.:|.|..
Mouse   192 LAVEWGPQNIRVNSLAPGAISGTEGLRRLRGSNASSKLKHFSNPIPRLGTKTEIAHSVLYLASPL 256

  Fly   299 AGYITGESIVAGGG 312
            |.|::|..:|..||
Mouse   257 ASYVSGIVLVVDGG 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 74/274 (27%)
fabG 67..316 CDD:235975 74/274 (27%)
Decr2NP_036063.1 TER_DECR_SDR_a 26..273 CDD:187627 74/274 (27%)
PRK07576 26..271 CDD:236056 74/274 (27%)
Substrate binding. /evidence=ECO:0000250 126..128 0/1 (0%)
Microbody targeting signal. /evidence=ECO:0000250 290..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.