DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and oar2

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_594074.1 Gene:oar2 / 2543512 PomBaseID:SPAC3G9.02 Length:236 Species:Schizosaccharomyces pombe


Alignment Length:251 Identity:69/251 - (27%)
Similarity:113/251 - (45%) Gaps:31/251 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 VVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVHGLKCH--VSEPEDRKQ 137
            ::|..:.|:|..||:..::.|....|..|.:.::...|..|.......|.|...  .|:.::.|.
pombe     5 LITGGSSGLGKRIAQIWSQKGHQCHIVGRNEFHLKETLQSLSVAKGQQHTLTIADVQSDMKNLKS 69

  Fly   138 LFEETISKFGKLNILVSNAATNPAVGGVLE---C---DEKVWDKIFDVNVKSSYLLAKEALPLLR 196
            :||..     :::.:|..|       |||:   |   .||..|.|...|:.|:..|:|.|:....
pombe    70 IFESV-----EIDTVVHAA-------GVLQSSLCVRTSEKEIDSIICTNLVSAIKLSKMAILEWF 122

  Fly   197 QQKNSS----IVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRTK 257
            :.|||.    |:.:||.....|......|:.||..|...||..|.::|.:|||||.::||.:.|.
pombe   123 RNKNSERDRLILNISSRLSTYALPGTSVYAASKAGLESFTKVLAAEVASKGIRVNAISPGYVDTP 187

  Fly   258 FSKALYENESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGGM 313
            ..     :......|..|:|:|||.:::|:....:||:  |..|.||..:...||:
pombe   188 ML-----SSQIRAIAEKKVPIGRLASTDEIVDACTFLL--DNRYTTGTILPITGGL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 69/251 (27%)
fabG 67..316 CDD:235975 69/251 (27%)
oar2NP_594074.1 FabG 1..236 CDD:223959 68/249 (27%)
SDR_c 4..233 CDD:212491 67/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.