DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and SPAC8E11.10

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_594161.1 Gene:SPAC8E11.10 / 2543428 PomBaseID:SPAC8E11.10 Length:255 Species:Schizosaccharomyces pombe


Alignment Length:261 Identity:78/261 - (29%)
Similarity:137/261 - (52%) Gaps:17/261 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 TMKRLAGKVAVVTASTDGIGFAIAKRLAEDGAAV-VISSRKQKNVDSALAELRKLNLNVHGL--K 126
            :|..|.||..::|..:.||||:|||..|..|:.| ::..|.:|.::.| ||||    :.||:  |
pombe     3 SMFSLKGKTTLITGGSGGIGFSIAKAFAAAGSNVGLLYGRNKKALEYA-AELR----DKHGVQAK 62

  Fly   127 CHVSEPEDRKQLFEETISKF----GKLNILVSNAATNPAVGGVLECDEKVWDKIFDVNVKSSYLL 187
            .:....|:|..:.|.|....    |:|:::::||........:.:.:|.:|.|:..:|:..:|..
pombe    63 AYSCPIENRSAVIETTNQAVEELGGRLDVMIANAGIAIPHLSLEDKNEDIWTKVVGINLNGAYYT 127

  Fly   188 AKEALPLLRQQKNSSIVFVSSIAGYDAF--ELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLA 250
            |:.|....::|...|::|.:|::|:.|.  :...:|..:|.|:..|.:|.|.:.||.. |||.::
pombe   128 AQAAGHHFKKQGKGSLIFTASMSGHIANWPQQWASYHATKAAVKHLARALAVEWAPFA-RVNSVS 191

  Fly   251 PGVIRTKFSKALYENESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGGMTA 315
            ||.|.|..:  ||.:|:..:......|..|:|..:|:.|...:|.|:.:.|.||..|:..||..:
pombe   192 PGYIDTDLT--LYADENLRKKWKEYTPQARIGLPDELPGAYLYLASDASSYCTGSDIIVDGGYCS 254

  Fly   316 R 316
            |
pombe   255 R 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 77/259 (30%)
fabG 67..316 CDD:235975 76/257 (30%)
SPAC8E11.10NP_594161.1 PRK05867 1..252 CDD:135631 76/256 (30%)
MDH-like_SDR_c 2..254 CDD:187610 77/258 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.