DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and SPAC22A12.17c

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_593247.1 Gene:SPAC22A12.17c / 2541844 PomBaseID:SPAC22A12.17c Length:261 Species:Schizosaccharomyces pombe


Alignment Length:250 Identity:69/250 - (27%)
Similarity:119/250 - (47%) Gaps:11/250 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLN-LNVHGLKCHVSEP 132
            |.||.|||.....|||.||....||.||...|....... :.|..|:.:.| :..:..||.|:.|
pombe    19 LKGKNAVVFGGARGIGHAICSVFAEAGANAFIVYNTTPG-EKAAKEIAQANGVKTYTCKCDVTIP 82

  Fly   133 EDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIFDVNVKSSYLLAKEALPLLRQ 197
            ::.:..|.|....|..::|:|.|.........:....|:..::| :||:...:.:|..|.|:.::
pombe    83 KEVEHAFAEIQKVFDTIDIVVPNNGICTGKSAIDMTYEEFANEI-NVNLLGVFNVAHNAGPIFQK 146

  Fly   198 QKNSSIVFVSSIAG--YDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRTKFSK 260
            |.:.|:|..:|::|  .:..:...||:.||..:|.|.|:.|.:.. :..||||::||...:..:.
pombe   147 QGHGSLVATASMSGVVVNVPQQQCAYNTSKAGVIQLIKSLAVEWR-KFARVNCVSPGYTTSDMTG 210

  Fly   261 ALYENESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGGMTA 315
            ..:..|..     ...|..|.|.::|:|....:|.|:.|.|.:|.:::..||.|:
pombe   211 GKFHKEWE-----PYTPFERNGLAKEIASAYLYLASDAASYASGTNLIVDGGYTS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 69/249 (28%)
fabG 67..316 CDD:235975 69/249 (28%)
SPAC22A12.17cNP_593247.1 MDH-like_SDR_c 14..260 CDD:187610 68/248 (27%)
fabG 18..257 CDD:235500 66/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.