DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and Cbr4

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_663570.2 Gene:Cbr4 / 234309 MGIID:2384567 Length:236 Species:Mus musculus


Alignment Length:244 Identity:84/244 - (34%)
Similarity:124/244 - (50%) Gaps:16/244 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 KVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVHGLKCHVSEPEDRK 136
            ||..|...:.|||.|:|:.:|:.|..:.|.||   |::.|.....:|..|....:|.|::.:|.:
Mouse     3 KVCAVFGGSRGIGRAVAQLMAQKGYRLAIVSR---NLEVAKVTAGELGGNHLAFRCDVAKEQDVQ 64

  Fly   137 QLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKI--FDVNVKSSYLLAKEALPLLRQQK 199
            ..|:|.....|.:|.||:.|..|   ...|....|..|.|  ...|:..|.|..|.|:..:.|| 
Mouse    65 STFQEMEKHLGPVNFLVNAAGIN---RDSLLVRTKTEDMISQLHTNLLGSMLTCKAAMKTMIQQ- 125

  Fly   200 NSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRTKFSKALYE 264
            ..|||.|.||.|........|||.:|..|:|.:::.||::|.:.||||.:|||.|||..::.|.|
Mouse   126 GGSIVNVGSIIGLKGNVGQSAYSATKGGLVGFSRSLAKEVARKKIRVNVVAPGFIRTDMTRHLKE 190

  Fly   265 NESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGGM 313
                 |.....||:||.|.:.|:|..|.||:  ::.||||..::..||:
Mouse   191 -----EHFKKNIPLGRFGETLEVAHAVVFLL--ESPYITGHVLIVDGGL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 84/244 (34%)
fabG 67..316 CDD:235975 84/244 (34%)
Cbr4NP_663570.2 fabG 1..234 CDD:235546 84/244 (34%)
NADB_Rossmann 3..232 CDD:304358 83/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.