DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and decr-1.2

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_495805.1 Gene:decr-1.2 / 189090 WormBaseID:WBGene00012177 Length:309 Species:Caenorhabditis elegans


Alignment Length:256 Identity:77/256 - (30%)
Similarity:123/256 - (48%) Gaps:23/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVHGLKCH-----VS 130
            ||:.:||....|||.|||...|...|.|||::|:.:.::....::.|:.    |..|.     :.
 Worm    25 GKLVLVTGGGTGIGKAIATTFAHLRATVVIAARRMEKLEQTARDITKIT----GGTCEPFQMDIK 85

  Fly   131 EPEDRKQLFEETISKFGKL-NILVSNAATNPAVGGVLECDEKVWDKIFDVNVKSSYLLAKEALPL 194
            :|......|::...||||: .|||:|||.|..:...| .....:..|.|:.:|.::.:..|....
 Worm    86 DPGMVSDAFDKIDMKFGKVPEILVNNAAGNFIMATEL-LSSNAYGTIIDIVLKGTFNVTTELGKR 149

  Fly   195 LRQQKNSSIVFVSSIAGYDAFELLGA-----YSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVI 254
            ..|.|..:.: .|..|||   ...||     .:|||..:..:||:.|.:.:..|:|.|.::||.|
 Worm   150 CIQNKTGASI-TSITAGY---ARAGAPFIVPSAVSKAGVETMTKSLATEWSKYGLRFNAVSPGPI 210

  Fly   255 RTKFS-KALYENESANEAALSKI--PMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGG 312
            .||.: ..|...|..:.|...|.  |.||:|:.||:|.:|:|:.|:...::.|..|...||
 Worm   211 PTKGAWGRLNSGEMGDIAEKMKFLNPEGRVGSPEEVANLVAFISSDHMSFLNGAIIDLDGG 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 77/256 (30%)
fabG 67..316 CDD:235975 77/256 (30%)
decr-1.2NP_495805.1 TER_DECR_SDR_a 23..274 CDD:187627 77/256 (30%)
PRK07677 25..272 CDD:181077 77/256 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.