DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and F59E11.2

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_505327.2 Gene:F59E11.2 / 186621 WormBaseID:WBGene00019109 Length:321 Species:Caenorhabditis elegans


Alignment Length:271 Identity:75/271 - (27%)
Similarity:119/271 - (43%) Gaps:48/271 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNL--------NVHGL 125
            |..:||:||.::.|||..||.:|.|.||.|.|:.|:.:..|:....|..|:.        ...|:
 Worm     5 LQDQVALVTGASRGIGRGIALQLGEAGATVYITGRRPELSDNFRLGLPSLDYVAKEITSRGGKGI 69

  Fly   126 KCHV--SEPEDRKQLFEE-TISKFGKLNILVSNA------ATNPAVGGVLECDEKVWDKIFDVNV 181
            ..:|  |...:.|.|||: ...:.|||:|||:|.      ||........:.|...||.|..|.:
 Worm    70 ALYVDHSNMTEVKFLFEKIKEDEEGKLDILVNNVYNSLGKATEMIGKTFFDQDPSFWDDINGVGL 134

  Fly   182 KSSYLLAKEALPLLRQQKNSSIVFVSSIAGYD-AFELLGAYSVSKTALIGLTKAAAKDLAPEGIR 245
            ::.|..:..|..::.:::...||.|.|:.|.. .|.:  ||...|.||..::...|.:|.|..:.
 Worm   135 RNHYYCSVYAARMMVERRKGLIVNVGSLGGLKYVFNV--AYGAGKEALARMSTDMAVELNPYNVC 197

  Fly   246 VNCLAPGVIRTKFS---------KALYENESANE-----------AALSKIPM--GRLGTS---- 284
            |..|.||.::|:.:         |.:.||....|           .||:::.|  |:|..|    
 Worm   198 VVTLIPGPVKTETANRTIIDDAYKMIKENPELEEFIKGESTEYTGKALARLAMDPGKLKKSGKTL 262

  Fly   285 --EEMAGVVSF 293
              |::|....|
 Worm   263 FTEDLAQKYDF 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 75/271 (28%)
fabG 67..316 CDD:235975 75/271 (28%)
F59E11.2NP_505327.2 PRK08303 5..281 CDD:236229 75/271 (28%)
NADB_Rossmann 5..278 CDD:304358 75/271 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.