DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and F28H7.2

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_505742.1 Gene:F28H7.2 / 185096 WormBaseID:WBGene00009236 Length:284 Species:Caenorhabditis elegans


Alignment Length:270 Identity:93/270 - (34%)
Similarity:144/270 - (53%) Gaps:31/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 MKRLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNL-------NVH 123
            |.|...|||::|.|::|||.|.|:.||.:||.|.::.|..:.    |.|.:.:.|       ||.
 Worm     1 MSRFTDKVAIITGSSNGIGQATARLLASEGAKVTVTGRNAER----LEETKNILLGAGVPEGNVL 61

  Fly   124 GLKCHVSEPEDRKQLFEETISKFGKLNILVSNAATN-PAVGGVLECDEKV--WDKIFDVNVKSSY 185
            .:...:::...::.|.:.|:.||||::|||:||... |...|....::.:  :.|.|::||:|..
 Worm    62 VVVGDITQESVQENLIKSTLDKFGKIDILVNNAGAGIPDAQGKSGVNQSIDTYHKTFELNVQSVI 126

  Fly   186 LLAKEALPLLRQQKNSSIVFVSSIAGYDAFELLGA-YSVSKTALIGLTKAAAKDLAPEGIRVNCL 249
            .:.::|.|.|.:.: ..||.:|||....|.::... ||::|.||...|:.||.||.|||||||.:
 Worm   127 EMTQKARPHLAKTQ-GEIVNISSIGAGPAAQVASPYYSIAKAALDQYTRTAAIDLVPEGIRVNSV 190

  Fly   250 APGVIRTKF-----------SKALYENESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDA-GYI 302
            :||.:.|.|           |||.|:...|....   ||.|.....|::|.|::||...:| .||
 Worm   191 SPGAVSTGFSAVSRGLTEEKSKAFYDYLGAQREC---IPRGFCAVPEDIAKVIAFLADRNASNYI 252

  Fly   303 TGESIVAGGG 312
            .|::|||.||
 Worm   253 IGQTIVADGG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 92/269 (34%)
fabG 67..316 CDD:235975 92/269 (34%)
F28H7.2NP_505742.1 fabG 3..262 CDD:235506 90/266 (34%)
NADB_Rossmann 4..266 CDD:304358 91/267 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1194344at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.