DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and F26D2.15

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_507157.1 Gene:F26D2.15 / 184969 WormBaseID:WBGene00009153 Length:279 Species:Caenorhabditis elegans


Alignment Length:267 Identity:87/267 - (32%)
Similarity:136/267 - (50%) Gaps:26/267 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 MKRLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNL---NVHGLKC 127
            |.|.:||||::|.|::|||.|.|...|:.||.|.|:.|..:.:.....|::|..:   |:..:..
 Worm     1 MARFSGKVALITGSSNGIGRAAAILFAQQGAKVTITGRNAERLKETRHEIKKSGIPAENILAIVA 65

  Fly   128 HVSEPEDRKQLFEETISKFGKLNILVSNA--ATNPAVGGV-LECDEKVWDKIFDVNVKSSYLLAK 189
            .|...|.:.:|..:|:.|||.|:|||:||  |...|.|.| ::.|..|:|....:|::|...|.:
 Worm    66 DVITDEGQMRLINDTVRKFGHLDILVNNAGGALMDAQGRVGMDQDISVFDNTMQINMRSVVTLVQ 130

  Fly   190 EALPLLRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVI 254
            :|...|.:.|...|...:..||:....:...|.:||.||...|:::|..|...|:|||.::||..
 Worm   131 KAKEHLIKSKGEIINVSAMAAGHHGDPIATFYGMSKAALDQFTRSSAISLIQHGVRVNSVSPGFT 195

  Fly   255 RTKFSKAL-------------YENESANEAALSKIPMGRLGTSEEMAGVVSFLVSED-AGYITGE 305
            :|.|.:|:             |  ||..|.|    |.|.:....::|.|:.||.... :.||.|:
 Worm   196 KTGFGEAMGFPPIAMKKVISFY--ESHKECA----PSGAIAQPGDIAQVILFLADRTMSSYIIGQ 254

  Fly   306 SIVAGGG 312
            ||:|.||
 Worm   255 SIIADGG 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 86/266 (32%)
fabG 67..316 CDD:235975 86/266 (32%)
F26D2.15NP_507157.1 fabG 3..265 CDD:235975 86/265 (32%)
NADB_Rossmann 4..265 CDD:304358 85/264 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.