DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and C06B8.3

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_506855.2 Gene:C06B8.3 / 182298 WormBaseID:WBGene00007369 Length:162 Species:Caenorhabditis elegans


Alignment Length:143 Identity:45/143 - (31%)
Similarity:70/143 - (48%) Gaps:10/143 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 VNVKSSYLLAKEALPLLRQQKNSSIVFVSSIA-GYDAFELLGAYSVSKTALIGLTKAAAKDLAPE 242
            :|::|...|.::|...|.:.| ..|:.||||| |......:..|.:||..|...|:::|..|...
 Worm     3 INMRSVITLVQKAKEHLIKTK-GEIINVSSIASGPHGDSQMTYYGMSKADLNHFTRSSAISLIQH 66

  Fly   243 GIRVNCLAPGVIRTKFSKALYENESANEAALSK-------IPMGRLGTSEEMAGVVSFLVSED-A 299
            |:|||.::||...|.|..|:.....|.|..:..       ||.|.:....::|.::.||.... :
 Worm    67 GVRVNSVSPGFTLTGFGDAMGFPPGALEKVIKHYASHKECIPSGVVARPGDIAQIILFLADRTMS 131

  Fly   300 GYITGESIVAGGG 312
            .||.|:||:|.||
 Worm   132 SYIIGQSIIADGG 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 45/143 (31%)
fabG 67..316 CDD:235975 45/143 (31%)
C06B8.3NP_506855.2 NADB_Rossmann <1..148 CDD:304358 45/143 (31%)
FabG <1..144 CDD:223959 43/141 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1194344at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.