DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and dhs-26

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_508580.2 Gene:dhs-26 / 180624 WormBaseID:WBGene00000989 Length:321 Species:Caenorhabditis elegans


Alignment Length:263 Identity:76/263 - (28%)
Similarity:120/263 - (45%) Gaps:27/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSR-KQKNVDSALAELRKL-----NLNVHGLKC 127
            |..|:|:||.::.|.|..:|.:|||.|..:.|:.| ..|.:.|.|..|..|     .....|..|
 Worm     3 LKSKIAIVTGASRGCGRGVALQLAEAGCTLYITGRAPSKTLSSELTYLPTLEGTAEECRKRGGIC 67

  Fly   128 HV-----SEPEDRKQLFEETISKF-GKLNILVSNA--ATNPAVGG----VLECDEKVWDKIFDVN 180
            ||     |..::.::.|:|..|:. .:|:|||:||  |......|    ..|.|.::||.|.:|.
 Worm    68 HVRYVDHSNMDEVEKFFDEVASETDNQLDILVNNAFSAVTKCGSGDTRKFFERDPEIWDDINNVG 132

  Fly   181 VKSSYLLAKEALPLLRQQKNSS---IVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPE 242
            :::.|..:.....::|  ||..   ||.:||:.|. .:....||.|.|.||..::...|::|...
 Worm   133 LRNQYYCSVYGTRIMR--KNGMKGLIVNISSLGGI-MYLFTVAYGVGKMALDRMSSDMAQELQDT 194

  Fly   243 GIRVNCLAPGVIRTKFSKALYENESANEAALSKIPMGRLGTSEEMAG--VVSFLVSEDAGYITGE 305
            ||.|..|.|..::|:....:.|. ||.....::..|...|.|.|..|  ||:........|..|.
 Worm   195 GITVISLWPSAVKTELITNMIET-SAGSWGATENKMFLNGESTEYCGKAVVAIAADPKKKYWNGS 258

  Fly   306 SIV 308
            :::
 Worm   259 TLI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 76/263 (29%)
fabG 67..316 CDD:235975 76/263 (29%)
dhs-26NP_508580.2 PRK08303 1..286 CDD:236229 76/263 (29%)
DHRS1-like_SDR_c 3..278 CDD:187664 76/263 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1194344at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.