DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and dhs-25

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_508282.2 Gene:dhs-25 / 180486 WormBaseID:WBGene00000988 Length:248 Species:Caenorhabditis elegans


Alignment Length:253 Identity:83/253 - (32%)
Similarity:132/253 - (52%) Gaps:17/253 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVHGLKCHVSEPE 133
            |.|::||||....|||.||::.||:.||.||::.....|. :|.|:....:.:.....|.||..:
 Worm     5 LGGRIAVVTGGASGIGKAISQTLAKHGARVVVADLDSGNA-AATAKALPASQSHSSFACDVSNAD 68

  Fly   134 DRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIFDVNVKSSYLLAKEALPLLRQQ 198
            ..|.| .|.:...|..:||| |.|.......:|:..::.||.:..||:...:.:::..:......
 Worm    69 SVKGL-SEHVKSLGTPSILV-NCAGITKDSTLLKMKQEQWDSVIKVNLTGVFHVSQAFVKASVDN 131

  Fly   199 KNS--SIVFVSSIAGYDAFELLG-----AYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRT 256
            .|.  ||:.||||.|     .:|     .|:.:|..:||.||:|||:||.:.:|||.:.||.|:|
 Worm   132 NNHPLSIINVSSIVG-----KMGNFGQTNYAATKAGVIGFTKSAAKELAKKNVRVNAVLPGFIKT 191

  Fly   257 KFSKALYENESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGGMT 314
            ..::|:.....|.  ....|||||:|.:||:|..|.:|.|:.:.|:||.::...||.:
 Worm   192 PMTEAMPPTVLAE--ICKGIPMGRMGEAEEIANSVLYLASDLSSYVTGATLEVTGGFS 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 83/253 (33%)
fabG 67..316 CDD:235975 83/253 (33%)
dhs-25NP_508282.2 fabG 4..248 CDD:235546 83/253 (33%)
BKR_SDR_c 8..245 CDD:187594 79/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X181
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.