DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and dhs-15

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_503754.1 Gene:dhs-15 / 178739 WormBaseID:WBGene00000978 Length:278 Species:Caenorhabditis elegans


Alignment Length:274 Identity:88/274 - (32%)
Similarity:142/274 - (51%) Gaps:36/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 MKRLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKL-----NLNVHGL 125
            |.|.:.|||::|.|:.|||.:.|..||::||.|.::.|..:.:...:.|:.|.     |:|:  :
 Worm     1 MGRFSDKVAIITGSSSGIGRSTAVLLAQEGAKVTVTGRSSEKIQETVNEIHKNGGSSDNINI--V 63

  Fly   126 KCHVSEPEDRKQLFEETISKFGKLNILVSNA-----------ATNPAVGGVLECDEKVWDKIFDV 179
            ...::|.|.:.:|.:.|:|:|||::||::||           .:..|:|        ::|.:..:
 Worm    64 LGDLNESECQDELIKSTLSRFGKIDILINNAGAAFADPSGKIGSEAAIG--------IFDDMMKL 120

  Fly   180 NVKSSYLLAKEALPLLRQQKNSSIVFVSSI-AGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEG 243
            |::|...|.|:..|.|...| ..||.|||| ||...:.....|.:.|..|..||::.|.:|.|..
 Worm   121 NLRSVVELVKKCRPHLIASK-GEIVNVSSIAAGPQPYIYYTYYGICKAGLDQLTRSLALELIPFD 184

  Fly   244 IRVNCLAPGVIRTKFSKA-------LYENESANEAALSKIPMGRLGTSEEMAGVVSFLVS-EDAG 300
            :|||.::||:|.|.|..|       :.:.|.........||.||.|..||:|.:::||.. :.:.
 Worm   185 VRVNSVSPGLISTNFLGAVGMGDDVVKKTEEYYSTHRDCIPAGRTGKPEEIASLIAFLADRKSSA 249

  Fly   301 YITGESIVAGGGMT 314
            ||.|:|||..||.|
 Worm   250 YIIGQSIVIDGGTT 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 87/273 (32%)
fabG 67..316 CDD:235975 87/273 (32%)
dhs-15NP_503754.1 FabG 2..261 CDD:223959 84/269 (31%)
NADB_Rossmann 4..265 CDD:304358 86/271 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1194344at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.