DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and dhs-9

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_498146.1 Gene:dhs-9 / 175737 WormBaseID:WBGene00000973 Length:319 Species:Caenorhabditis elegans


Alignment Length:281 Identity:79/281 - (28%)
Similarity:125/281 - (44%) Gaps:66/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRK-QKNVDSALAELRKLNLNVHGLKCHVSE- 131
            |||::|:||.::.|||..||.:|.|.||.|.|:.|| :::::|      |:.|:  ||:....| 
 Worm     3 LAGQIAIVTGASRGIGRGIALQLGEAGATVYITGRKPEESLNS------KVGLS--GLEATADEI 59

  Fly   132 ----------------PEDRKQLFEETISKF-GKLNILVSNA-----ATNPAVG-GVLECDEKVW 173
                            .|:.|..||....:. |:|:|||:||     |.:..:| ...|.|..||
 Worm    60 TKRGGKGIARFVDHQNMEEVKNFFEVVEKEHQGQLDILVNNAYQGVTAISENMGKPFYETDPYVW 124

  Fly   174 DKIFDVNVKSSYLLAKEALPLLRQQKNSSIVFVSSIAGYD-AFELLGAYSVSKTALIGLTKAAAK 237
            |.|.:|.:::.|.....|..|:..:....||.|||..|.. .|.:  ||.|.|.||..::...|.
 Worm   125 DTINNVGLRNHYFCTVYAARLMTARNKGLIVNVSSGGGLRYLFNV--AYGVGKQALDRMSADTAV 187

  Fly   238 DLAPEGIRVNCLAPGVIRTKFSKALYENESANEAALSKIPMGRLGTSEEMA----------GVVS 292
            :|..:.:.|..:.||.:||:....::::|:..       |...:..:|..|          .|||
 Worm   188 ELRKKNVCVVSIWPGAVRTELVDKMFKDENGK-------PRPEIKNAEVFANGETVEYPGRAVVS 245

  Fly   293 -------------FLVSEDAG 300
                         .|::||.|
 Worm   246 LASDPRRMDKTGRILITEDLG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 79/281 (28%)
fabG 67..316 CDD:235975 79/281 (28%)
dhs-9NP_498146.1 PRK08303 1..279 CDD:236229 79/281 (28%)
NADB_Rossmann 3..276 CDD:304358 79/281 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.