DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and Y47G6A.21

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001021764.1 Gene:Y47G6A.21 / 171924 WormBaseID:WBGene00021646 Length:255 Species:Caenorhabditis elegans


Alignment Length:258 Identity:83/258 - (32%)
Similarity:137/258 - (53%) Gaps:30/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQ------KNVDSALAELRKLNLNVHGLKC---- 127
            ||::|.::.|||         .|.|::.:.:|.      :|.|| |.|:..|.::...:..    
 Worm     3 VAIITGASSGIG---------KGTALLFAKKKYQLSLTGRNTDS-LKEVAALCISEGAISADDIL 57

  Fly   128 ----HVSEPEDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIFDVNVKSSYLLA 188
                .:|..|..|.:.:.|:.|||:::.|:::|....| |.||:...:|:|::.:|||:|...|.
 Worm    58 ITAVELSSDEAPKAIVDATVQKFGRIDSLINSAGILRA-GPVLDSGIEVYDELMNVNVRSLIRLT 121

  Fly   189 KEALPLLRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGV 253
            :.|||.:...| .::|.||||.|...|..:..|.:||:|:...||..|.::||.|:|||.:.|||
 Worm   122 RAALPHIITTK-GTVVNVSSINGPCPFAGVTYYCMSKSAVDQFTKCLALEMAPNGVRVNAVCPGV 185

  Fly   254 IRTKFSKALYENESANEAALSKI----PMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGG 312
            |.|...:|..::|:...|.|.|.    .:||.||:.|:|..:.||.||.:.:.||:.:...||
 Worm   186 IVTNIHRASGQDEATYAAFLEKSKTTHALGRPGTTSEVAEAILFLSSEKSSFTTGQLLKVDGG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 83/258 (32%)
fabG 67..316 CDD:235975 83/258 (32%)
Y47G6A.21NP_001021764.1 FabG 1..249 CDD:223959 83/258 (32%)
NADB_Rossmann 3..252 CDD:304358 83/258 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.