DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and R119.3

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_490726.1 Gene:R119.3 / 171628 WormBaseID:WBGene00020089 Length:253 Species:Caenorhabditis elegans


Alignment Length:250 Identity:79/250 - (31%)
Similarity:138/250 - (55%) Gaps:6/250 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 AVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVHGLKCHVSEPEDRKQL 138
            |:|..:|..:|.|:.:|||..|..|..::....:|.....:..|:..:|......|:..|.||:|
 Worm     4 ALVIGATSTLGKAVVRRLAFTGYKVAAAADCPNSVGKVAEDNIKVGGDVTAFSLDVANAEHRKEL 68

  Fly   139 FEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIFDVNVKSSYLLAKEALPLLRQQKNSSI 203
            ..:...|.|.|:.|:.....|..:|.::|...:.:||:|..|:.:.:.|::.|:..|.:.:|.||
 Worm    69 ITKVAEKLGGLDTLIIVPPQNEVLGEIIETSGEDFDKLFANNLTTPFRLSQAAMSTLAKSQNGSI 133

  Fly   204 VFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRTKFSKALYENESA 268
            ::::|..|:.....:|.|||:.::::.|||:.|:..|.:|:|||.:..|:|....:.|::::.|.
 Worm   134 IYLTSCFGFTPSIDMGLYSVASSSVLSLTKSVAQSAAKQGVRVNSVVSGMIEGDGTGAVWDHASG 198

  Fly   269 NEAAL------SKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGGMTARL 317
            .||..      |.||:||||...::|..|.||.|..|.|||||:.:.|||::.||
 Worm   199 EEARQIKQHLESMIPLGRLGRPSDVASYVEFLASTKARYITGENCIVGGGVSYRL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 77/248 (31%)
fabG 67..316 CDD:235975 77/247 (31%)
R119.3NP_490726.1 fabG 4..249 CDD:235500 76/244 (31%)
SDR_c 4..241 CDD:212491 72/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.772507 Normalized mean entropy S1637
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1194344at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.