DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and DECR1

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001350.1 Gene:DECR1 / 1666 HGNCID:2753 Length:335 Species:Homo sapiens


Alignment Length:284 Identity:77/284 - (27%)
Similarity:132/284 - (46%) Gaps:15/284 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NYSRKLVGPNLNQCHKRLSSSSQSSTAGTMKRLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVIS 101
            :|..|::..|......:..|..|.:.. ......||||.:|....|:|..:...|:..||..||:
Human    26 SYGTKILYQNTEALQSKFFSPLQKAML-PPNSFQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIA 89

  Fly   102 SRKQKNVDSALAELRKLNLN-VHGLKCHVSEPEDRKQLFEETISKFGKLNILVSNAATNPAVGGV 165
            |||...:.:...::.....| ||.::|.|.:|:..:....|.|...|..||:::|||.| .:...
Human    90 SRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGN-FISPT 153

  Fly   166 LECDEKVWDKIFDVNVKSSYLLAKE-ALPLLRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALI 229
            .......|..|.|:.:..:..:..| ...|::.||.::.:.:::|........:...:.:|..:.
Human   154 ERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVE 218

  Fly   230 GLTKAAAKDLAPEGIRVNCLAPGVIRTK--FSK----ALYENESANEAALSKIPMGRLGTSEEMA 288
            .::|:.|.:....|:|.|.:.||.|:||  ||:    ..:|.|     .:.:||.|||||.||:|
Human   219 AMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKE-----MIGRIPCGRLGTVEELA 278

  Fly   289 GVVSFLVSEDAGYITGESIVAGGG 312
            .:.:||.|:.|.:|.|..|...||
Human   279 NLAAFLCSDYASWINGAVIKFDGG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 72/254 (28%)
fabG 67..316 CDD:235975 72/254 (28%)
DECR1NP_001350.1 TER_DECR_SDR_a 57..303 CDD:187627 72/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.