DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and Decr1

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_476545.2 Gene:Decr1 / 117543 RGDID:70999 Length:335 Species:Rattus norvegicus


Alignment Length:253 Identity:75/253 - (29%)
Similarity:127/253 - (50%) Gaps:20/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVD--SALAE--LRKLNLNVHGLKCHVSE 131
            ||||.:|....|:|.|:...|:..||..||:||   |:|  .|.||  ..|....|:.::|.|.:
  Rat    59 GKVAFITGGGTGLGKAMTTFLSSLGAQCVIASR---NIDVLKATAEEITSKTGNKVYAIRCDVRD 120

  Fly   132 PEDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKV----WDKIFDVNVK-SSYLLAKEA 191
            |:.......|.|...|..:::::|||     |..:...|::    |..|.|:.:. ::|:..:..
  Rat   121 PDMVHNTVLELIKVAGHPDVVINNAA-----GNFISPSERLSPNGWKTITDIVLNGTAYVTLEIG 180

  Fly   192 LPLLRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRT 256
            ..|::.||.::.:.:::|........:...|.:|:.:..:.|:.|.:....|:|.|.:.||.|:|
  Rat   181 KQLIKAQKGAAFLAITTIYAESGSGFVMPSSSAKSGVEAMNKSLAAEWGRYGMRFNIIQPGPIKT 245

  Fly   257 K--FSKALYENESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVAGGG 312
            |  ||: |.......:..:.:||.|||||.||:|.:.:||.|:.|.:|.|..|...||
  Rat   246 KGAFSR-LDPTGKFEKDMIERIPCGRLGTVEELANLATFLCSDYASWINGAVIRFDGG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 75/253 (30%)
fabG 67..316 CDD:235975 75/253 (30%)
Decr1NP_476545.2 TER_DECR_SDR_a 57..303 CDD:187627 75/253 (30%)
PRK07677 59..303 CDD:181077 75/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.