DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and DHRS1

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001129522.1 Gene:DHRS1 / 115817 HGNCID:16445 Length:313 Species:Homo sapiens


Alignment Length:247 Identity:62/247 - (25%)
Similarity:103/247 - (41%) Gaps:23/247 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRKLNLNVHGLKCHVSEPEDR 135
            |:|.|||.::.|||..||.:|.:.||.|.|:.|....:.....|.:.|......:.|..|:..:.
Human     7 GQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEV 71

  Fly   136 KQLFEET-ISKFGKLNILVSNA------ATNPAVGGVLECDEKVWDKIFDVNVKSSYLLAKEALP 193
            :.|||:. ..:.|:|::||:||      ..|.......|....:||.|.:|.::..|..:.....
Human    72 RSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGAR 136

  Fly   194 LLRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAPGVIRTKF 258
            |:.......||.:|| .|...:.....|.|.|.|...|....|.:|...|:....|.||:::|:.
Human   137 LMVPAGQGLIVVISS-PGSLQYMFNVPYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTEL 200

  Fly   259 SKA-LYENESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESIVA 309
            .|. :.:.|...:..|.:..              |...|.:...::|:.:||
Human   201 LKEHMAKEEVLQDPVLKQFK--------------SAFSSAETTELSGKCVVA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 62/247 (25%)
fabG 67..316 CDD:235975 62/247 (25%)
DHRS1NP_001129522.1 PRK08303 1..271 CDD:236229 62/247 (25%)
DHRS1-like_SDR_c 5..271 CDD:187664 62/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.