DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and Pecr

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_579833.1 Gene:Pecr / 113956 RGDID:70925 Length:303 Species:Rattus norvegicus


Alignment Length:271 Identity:84/271 - (30%)
Similarity:134/271 - (49%) Gaps:27/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SSQSSTAGTMKRLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELR----- 116
            |.||..|..:  |..:|||||....|||.||::.|...|..|||:|||...:.:|:.|||     
  Rat     6 SGQSYLAAGL--LQNQVAVVTGGATGIGKAISRELLHLGCNVVIASRKLDRLTAAVDELRASQPP 68

  Fly   117 KLNLNVHGLKCHVSEPEDRKQLFEETISKFGKLNILVSNAATNPAVGGVL-----ECDEKVWDKI 176
            ..:..|..::|::.:.|:...|.:.|::|:||:|.||:||      ||..     :...|.|..:
  Rat    69 SSSTQVTAIQCNIRKEEEVNNLVKSTLAKYGKINFLVNNA------GGQFMAPAEDITAKGWQAV 127

  Fly   177 FDVNVKSSYLLAKEALPLLRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAP 241
            .:.|:..::.:.|.......:....|||.:..:.. :.|........::..:..|||..|...|.
  Rat   128 IETNLTGTFYMCKAVYNSWMKDHGGSIVNIIVLLN-NGFPTAAHSGAARAGVYNLTKTMALTWAS 191

  Fly   242 EGIRVNCLAPGVIRTKFSKALYEN-----ESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGY 301
            .|:|:||:|||.|   :|:...:|     ::..|.|...||..|:|..||::.:|.||:|..|.:
  Rat   192 SGVRINCVAPGTI---YSQTAVDNYGELGQTMFEMAFENIPAKRVGLPEEISPLVCFLLSPAASF 253

  Fly   302 ITGESIVAGGG 312
            |||:.|...||
  Rat   254 ITGQLINVDGG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 80/261 (31%)
fabG 67..316 CDD:235975 80/261 (31%)
PecrNP_579833.1 fabG 15..267 CDD:235546 80/262 (31%)
TER_DECR_SDR_a 16..267 CDD:187627 80/259 (31%)
Microbody targeting signal. /evidence=ECO:0000250 301..303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1194344at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X181
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.