DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and Pecr

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_076012.3 Gene:Pecr / 111175 MGIID:2148199 Length:303 Species:Mus musculus


Alignment Length:265 Identity:84/265 - (31%)
Similarity:135/265 - (50%) Gaps:28/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 AGTMKRLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELR-----KLNLNV 122
            ||.:|   .:|||||....|||.|:::.|...|..|||:|||...:.:|:.|||     ..:..|
Mouse    13 AGLLK---NQVAVVTGGGTGIGKAVSRELLHLGCNVVIASRKLDRLTAAVDELRASLPPSSSAEV 74

  Fly   123 HGLKCHVSEPEDRKQLFEETISKFGKLNILVSNAATNPAVGG-----VLECDEKVWDKIFDVNVK 182
            ..::|::.:.|:...|.:.|::|:||:|.||:|.      ||     |.:...|.|..:.:.|:.
Mouse    75 SAIQCNIRKEEEVSNLVKSTLAKYGKINFLVNNG------GGQFMAPVEDITAKGWHAVIETNLT 133

  Fly   183 SSYLLAKEALPLLRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVN 247
            .::.:.||......::...|||.:..:.. :.|........::..:..|||:.|...|..|:|:|
Mouse   134 GTFYMCKEVYNSWMREHGGSIVNIIVLLN-NGFPTAAHTGAAREGVYNLTKSMALAWASSGVRIN 197

  Fly   248 CLAPGVIRTKFSKALYEN-----ESANEAALSKIPMGRLGTSEEMAGVVSFLVSEDAGYITGESI 307
            |:|||.|   :|:...:|     ::..|.|...||..|||..||::.:|.||:|..|.||||:.|
Mouse   198 CVAPGTI---YSQTAVDNYGEMGQTLFEMAFDSIPAKRLGVPEEISPLVCFLLSPAASYITGQLI 259

  Fly   308 VAGGG 312
            ...||
Mouse   260 NVDGG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 82/261 (31%)
fabG 67..316 CDD:235975 82/261 (31%)
PecrNP_076012.3 fabG 32..267 CDD:235546 73/243 (30%)
TER_DECR_SDR_a 32..267 CDD:187627 73/243 (30%)
Microbody targeting signal. /evidence=ECO:0000250 301..303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X181
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.