Sequence 1: | NP_647946.1 | Gene: | CG10672 / 38598 | FlyBaseID: | FBgn0035588 | Length: | 317 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_766635.1 | Gene: | Cbr3 / 109857 | MGIID: | 1309992 | Length: | 277 | Species: | Mus musculus |
Alignment Length: | 240 | Identity: | 55/240 - (22%) |
---|---|---|---|
Similarity: | 103/240 - (42%) | Gaps: | 59/240 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 KVAVVTASTDGIGFAIAKRLAED-GAAVVISSRKQKNVDSALAELRKLNLNVHGLKCHVSEPEDR 135
Fly 136 KQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKV-WDKIFDVNVKSSYLLAK----EALPLL 195
Fly 196 RQQKNSSIVFVSSIAGYDAFE----------------------LL-------------------G 219
Fly 220 AYSVSKTALIGLTKAAAKDL----APEGIRVNCLAPGVIRTKFSK 260 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10672 | NP_647946.1 | NADB_Rossmann | 67..317 | CDD:304358 | 55/240 (23%) |
fabG | 67..316 | CDD:235975 | 55/240 (23%) | ||
Cbr3 | NP_766635.1 | carb_red_PTCR-like_SDR_c | 6..277 | CDD:187585 | 55/240 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |