DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10672 and DHRS2

DIOPT Version :9

Sequence 1:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_878912.1 Gene:DHRS2 / 10202 HGNCID:18349 Length:300 Species:Homo sapiens


Alignment Length:210 Identity:108/210 - (51%)
Similarity:143/210 - (68%) Gaps:1/210 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RLSSSSQSSTAGTMKRLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAELRK 117
            |||....|:.......||.:|||||.||.|||||||:|||.|||.||||||||:|||.|:|:|:.
Human    18 RLSVRMSSTGIDRKGVLANRVAVVTGSTSGIGFAIARRLARDGAHVVISSRKQQNVDRAMAKLQG 82

  Fly   118 LNLNVHGLKCHVSEPEDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIFDVNVK 182
            ..|:|.|:.|||.:.|||:||..:.:...|.::.||.:|..||.||..|...|::||||..||||
Human    83 EGLSVAGIVCHVGKAEDREQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVK 147

  Fly   183 SSYLLAKEALPLLRQQKNSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVN 247
            |..||..:.||.: :.:..:::.|||||.|:....||.|:||||||:|||:..|.:|||:.||||
Human   148 SPALLLSQLLPYM-ENRRGAVILVSSIAAYNPVVALGVYNVSKTALLGLTRTLALELAPKDIRVN 211

  Fly   248 CLAPGVIRTKFSKAL 262
            |:.||:|:|.|||.:
Human   212 CVVPGIIKTDFSKVV 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 104/196 (53%)
fabG 67..316 CDD:235975 104/196 (53%)
DHRS2NP_878912.1 SDR 27..>226 CDD:330230 104/199 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140621
Domainoid 1 1.000 238 1.000 Domainoid score I2300
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 260 1.000 Inparanoid score I3114
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57783
OrthoDB 1 1.010 - - D1194344at2759
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm40894
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43943
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2055
SonicParanoid 1 1.000 - - X181
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.900

Return to query results.
Submit another query.