DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gdap1 and Gsto2

DIOPT Version :10

Sequence 1:NP_647945.1 Gene:Gdap1 / 38597 FlyBaseID:FBgn0035587 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001012071.1 Gene:Gsto2 / 309465 RGDID:1310764 Length:248 Species:Rattus norvegicus


Alignment Length:95 Identity:24/95 - (25%)
Similarity:40/95 - (42%) Gaps:8/95 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FHPYNFHAQKVLMVFYEKKIDFFPYVVDLCNGEQYSNWFLNLNPKGDVPVLQDG-ALVIPSSTHI 95
            |.||:...:.||      |.....:.:...|.:...:|:...:|.|.||||::. ..:|..|...
  Rat    31 FCPYSHRTRLVL------KAKSIRHEIININLKNKPDWYYTKHPFGQVPVLENSQCQLIYESVIA 89

  Fly    96 INYVESKFRGDRSLKPAHNSKEFDQMLIFE 125
            ..|::..|.| |.|.|....:...|.::.|
  Rat    90 CEYLDDVFPG-RKLFPYDPYERARQKMLLE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gdap1NP_647945.1 GstA 30..297 CDD:440390 24/95 (25%)
GST_C_family 178..285 CDD:470672
Gsto2NP_001012071.1 GST_N_Omega 7..94 CDD:239353 17/68 (25%)
GST_C_Omega 108..230 CDD:198293 2/11 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.