DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gdap1 and Gdap1

DIOPT Version :10

Sequence 1:NP_647945.1 Gene:Gdap1 / 38597 FlyBaseID:FBgn0035587 Length:327 Species:Drosophila melanogaster
Sequence 2:XP_316195.4 Gene:Gdap1 / 1276804 VectorBaseID:AGAMI1_004921 Length:315 Species:Anopheles gambiae


Alignment Length:40 Identity:12/40 - (30%)
Similarity:19/40 - (47%) Gaps:13/40 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 KITAETSKTEV----KLEEGG---------LVETTETQVE 327
            |.:|.:|||.|    |.:..|         |.:|:.||::
Mosquito   126 KTSANSSKTVVIQPRKRKVAGQGSFRAQPKLGKTSSTQLK 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gdap1NP_647945.1 GstA 30..297 CDD:440390
GST_C_family 178..285 CDD:470672
Gdap1XP_316195.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.