DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fitm and fitm2

DIOPT Version :9

Sequence 1:NP_729053.2 Gene:Fitm / 38596 FlyBaseID:FBgn0035586 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_001018334.1 Gene:fitm2 / 552928 ZFINID:ZDB-GENE-050508-5 Length:252 Species:Danio rerio


Alignment Length:265 Identity:85/265 - (32%)
Similarity:133/265 - (50%) Gaps:57/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 LYLGSL-FVISVIGDFVP----FPKTYFARSDNLFNQYFVKIGWGWTLLFVVPFLVLSAYTITCG 194
            :||..| |.||::|..:.    .|::||:.|.|:.|.||||:.||||::.::||:..|.:.|.  
Zfish    24 IYLPHLFFCISLVGSVLKNAELVPESYFSSSRNVLNLYFVKVSWGWTIVLLLPFIAYSNFYIK-- 86

  Fly   195 DHKRMLRHHFPRIVIATFFWFFWTKLFNVVENSYGRC-------TTKG-YATKSSCLKAGHLWKG 251
            .|...|| ....:::||..|:..|:.|..:|:..|.|       ..:| :.||::|.|||..|.|
Zfish    87 SHMFALR-RLTSLLVATLVWYICTETFFYIEDITGSCYESNTMVVIRGEFDTKAACRKAGFFWDG 150

  Fly   252 FDISGHAFILIHSSLVLIEEARPIIRWETIKEHIRNERHNRSTAENSGTNPLRTLNEEQMRSLQF 316
            ||||||:|||.:||||::||..|::       ||:....|                         
Zfish   151 FDISGHSFILSYSSLVIMEEMVPML-------HIQPAYRN------------------------- 183

  Fly   317 LYKRLTPIIRTLFIGMAALQLLWDIMLVGTMLYYHRMIEKVISGIIAILTWYFTYRFWYP---TP 378
                  |.:..|::.:..:..:|..|...|.:|:|.:|:|::.....||.||.||:.||.   :|
Zfish   184 ------PPLDCLYLALNVIVAIWIWMFGCTSVYFHDIIDKILGTSCGILGWYMTYKVWYVKLFSP 242

  Fly   379 GLLPE 383
            ||.|:
Zfish   243 GLPPQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FitmNP_729053.2 Scs3p 157..371 CDD:287263 68/221 (31%)
fitm2NP_001018334.1 Scs3p 55..232 CDD:287263 66/217 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593680
Domainoid 1 1.000 104 1.000 Domainoid score I6691
eggNOG 1 0.900 - - E1_KOG3750
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H35254
Inparanoid 1 1.050 136 1.000 Inparanoid score I4550
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621925at2759
OrthoFinder 1 1.000 - - FOG0001836
OrthoInspector 1 1.000 - - oto39636
orthoMCL 1 0.900 - - OOG6_105238
Panther 1 1.100 - - LDO PTHR23129
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1295
SonicParanoid 1 1.000 - - X5529
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.