DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fitm and fitm1l

DIOPT Version :9

Sequence 1:NP_729053.2 Gene:Fitm / 38596 FlyBaseID:FBgn0035586 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_001338597.1 Gene:fitm1l / 503747 ZFINID:ZDB-GENE-050306-28 Length:290 Species:Danio rerio


Alignment Length:315 Identity:73/315 - (23%)
Similarity:120/315 - (38%) Gaps:88/315 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 IFFN------TDLKVALYLGSLF------VISVIGDFVPFPKTY------FARSDNLFNQYFVKI 171
            :|.|      |||...|...:.|      ::|.:..|.|....:      ||:..:...:.|::.
Zfish     1 MFLNSILVVITDLAAGLLGNTSFRRHFHLLLSALLLFGPLLSLWVSHYSVFAKRTHFLYRVFLRS 65

  Fly   172 GWGWTLLFVVPFLVLSAYTITCGDHKRMLR---HHFPRIVIATFFWFFWTKLFNVVENSYGRC-- 231
            |||||.:||..|:.:.::::     :|.|.   .|..|:.:|...|..:.||..::||:.|.|  
Zfish    66 GWGWTCIFVGSFVFVLSFSV-----RRSLTLSLRHLSRLAVAGGLWLGFRKLLCLLENATGSCYE 125

  Fly   232 -------TTKG-------------YATKSSCLKAGHLWKGFDISGHAFILIHSSLVLIEEARPII 276
                   .|.|             ..||.:|:::|.||:|:::|..|.:|....|:|.||.... 
Zfish   126 PLSAALEMTSGTNGEGHPLLLLREAETKETCVRSGMLWRGYEVSEDALLLCLCCLLLAEETAVF- 189

  Fly   277 RWETIKEHIRNERHNRSTAENSGTNPLRTLNEEQMRSLQFLYKRLTPIIRTLFIGMAALQLLWDI 341
                                    .|...|.......|           |.||:....|..||..
Zfish   190 ------------------------GPYLNLGGPSEAPL-----------RILFLFCVLLLSLWVF 219

  Fly   342 MLVGTMLYYHRMIEKVISGIIAILTWYFTYRFWY---PTPGLLPEAPGNGSFSYQ 393
            :|:..:.|:.....:::.|.:..|:|...|:.||   |: ...|..||.|..|.|
Zfish   220 LLLCLLAYFPEFPTQLLGGALGCLSWRALYQGWYRLGPS-WYCPGRPGVGLLSTQ 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FitmNP_729053.2 Scs3p 157..371 CDD:287263 53/238 (22%)
fitm1lNP_001338597.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593679
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621925at2759
OrthoFinder 1 1.000 - - FOG0001836
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23129
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.