DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fitm and Fitm1

DIOPT Version :9

Sequence 1:NP_729053.2 Gene:Fitm / 38596 FlyBaseID:FBgn0035586 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_001099507.1 Gene:Fitm1 / 290223 RGDID:1306911 Length:292 Species:Rattus norvegicus


Alignment Length:331 Identity:90/331 - (27%)
Similarity:137/331 - (41%) Gaps:69/331 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GPDITRSEARGTRPTAAPTSIREILVMGVIHLCKKTIFFNTDLKVALYLGS----------LFVI 143
            ||.:......|||..|    :...||..|:.:....::|.:: :.|..|||          |..:
  Rat     4 GPMVGAGPGAGTRVRA----LLGCLVKVVLWVASALLYFGSE-QAARLLGSPCLRRLYHAWLAAV 63

  Fly   144 SVIGDFVPF---PKTYFARSDNLFNQYFVKIGWGWTLLFVVPFLVLSAYTITCGDHKR--MLRHH 203
            .:.|..:.|   .:|.||...|.||..||...||||..|:..|::|..:..|    :|  :...|
  Rat    64 VIFGPLLQFHVNSRTIFASHGNFFNIKFVNSAWGWTCTFLGGFVLLVVFLAT----RRVAVTARH 124

  Fly   204 FPRIVIATFFWFFWTKLFNVVENSYGRC---TTKG-----YATKSSCLKAGHLWKGFDISGHAFI 260
            ..|:|:....|....:.|.::|:..|.|   ..:|     ...:.|||.|||.|:|:.:|.|.|:
  Rat   125 LSRLVVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLHELPDRKSCLAAGHQWRGYTVSSHTFL 189

  Fly   261 LIHSSLVLIEEARPIIRWETIKEHIRNERHNRSTAENSGTNPLRTLNEEQMRSLQFLYKRLTPII 325
            |....|::.|||....::..         |......     |||         |.||       :
  Rat   190 LTFCCLLMAEEAAVFAKYLA---------HGLPAGA-----PLR---------LVFL-------L 224

  Fly   326 RTLFIGMAALQLLWDIMLVGTMLYYHRMIEKVISGIIAILTWYFTYRFWYPTPGLLPEAPGNGSF 390
            ..|.:|      ||:.:|:.|::|:|:...||:...:....||.||..||..| ..|..||:|.|
  Rat   225 NVLLLG------LWNFLLLCTVIYFHQYTHKVVGAAVGTFAWYLTYGSWYHQP-WSPGIPGHGLF 282

  Fly   391 SYQREI 396
            ...|.|
  Rat   283 PRSRSI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FitmNP_729053.2 Scs3p 157..371 CDD:287263 60/223 (27%)
Fitm1NP_001099507.1 Scs3p 80..264 CDD:287263 60/223 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351875
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3750
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621925at2759
OrthoFinder 1 1.000 - - FOG0001836
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23129
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.