DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fitm and FITM1

DIOPT Version :9

Sequence 1:NP_729053.2 Gene:Fitm / 38596 FlyBaseID:FBgn0035586 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_981947.1 Gene:FITM1 / 161247 HGNCID:33714 Length:292 Species:Homo sapiens


Alignment Length:325 Identity:86/325 - (26%)
Similarity:136/325 - (41%) Gaps:69/325 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 GPDITRSEARGTRPTAAPTSIREILVMGVIHLCKKTIFFNTDLKVALYLGS----------LFVI 143
            ||.:......|.|..|....:.::|    :.:....::|.:: :.|..|||          |..:
Human     4 GPVVGAGLGAGARIQALLGCLLKVL----LWVASALLYFGSE-QAARLLGSPCLRRLYHAWLAAV 63

  Fly   144 SVIGDFVPF---PKTYFARSDNLFNQYFVKIGWGWTLLFVVPFLVLSAYTITCGDHKR--MLRHH 203
            .:.|..:.|   |:|.||...|.||..||...||||..|:..|::|..:..|    :|  :...|
Human    64 VIFGPLLQFHVNPRTIFASHGNFFNIKFVNSAWGWTCTFLGGFVLLVVFLAT----RRVAVTARH 124

  Fly   204 FPRIVIATFFWFFWTKLFNVVENSYGRC---TTKG-----YATKSSCLKAGHLWKGFDISGHAFI 260
            ..|:|:....|....:.|.::|:..|.|   ..:|     ...:.|||.|||.|:|:.:|.|.|:
Human   125 LSRLVVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLHELPDRRSCLAAGHQWRGYTVSSHTFL 189

  Fly   261 LIHSSLVLIEEARPIIRWETIKEHIRNERHNRSTAENSGTNPLRTLNEEQMRSLQFLYKRLTPII 325
            |....|::.|||....::..         |......     |||         |.||       :
Human   190 LTFCCLLMAEEAAVFAKYLA---------HGLPAGA-----PLR---------LVFL-------L 224

  Fly   326 RTLFIGMAALQLLWDIMLVGTMLYYHRMIEKVISGIIAILTWYFTYRFWYPTPGLLPEAPGNGSF 390
            ..|.:|      ||:.:|:.|::|:|:...||:...:....||.||..||..| ..|.:||:|.|
Human   225 NVLLLG------LWNFLLLCTVIYFHQYTHKVVGAAVGTFAWYLTYGSWYHQP-WSPGSPGHGLF 282

  Fly   391  390
            Human   283  282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FitmNP_729053.2 Scs3p 157..371 CDD:287263 60/223 (27%)
FITM1NP_981947.1 Scs3p 80..264 CDD:287263 60/223 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157879
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3750
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621925at2759
OrthoFinder 1 1.000 - - FOG0001836
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23129
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.