DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fitm and fitm2

DIOPT Version :9

Sequence 1:NP_729053.2 Gene:Fitm / 38596 FlyBaseID:FBgn0035586 Length:480 Species:Drosophila melanogaster
Sequence 2:XP_012826930.2 Gene:fitm2 / 100036626 XenbaseID:XB-GENE-950532 Length:263 Species:Xenopus tropicalis


Alignment Length:279 Identity:84/279 - (30%)
Similarity:129/279 - (46%) Gaps:57/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 LKVALYLGSLFVISVIGDFVPFPKTYFARSDNLFNQYFVKIGWGWTLLFVVPFLVLSAYTITCGD 195
            |...:.||.    |::.:..|.|.:|:....|:.|.||||..|||||..::||:.|:.|.:|...
 Frog    30 LLACIVLGG----SLLKELSPLPDSYWNNKRNVLNVYFVKFSWGWTLWLLLPFIALTNYKLTRST 90

  Fly   196 HKRMLRHHFPRIVIATFFWFFWTKLFNVVENSYGRC-------TTKGYATKSSCLKAGHLWKGFD 253
            .|.:.|  ...::::|..|:..|.||..:|:..|.|       ..|.:..:..|...|..|.|||
 Frog    91 TKVLRR--LSSLLVSTLIWYLCTNLFLYIEDITGSCYESEAMSDPKEHQDRRECRLHGGYWHGFD 153

  Fly   254 ISGHAFILIHSSLVLIEEARPIIRWETIKEHIRNERHNRSTAENSGTNPLRTLNEEQMRSLQFLY 318
            ||||.|:|.:..|:::||.       :|..:||.|||                           :
 Frog   154 ISGHCFLLSYCILLILEET-------SIIPNIRFERH---------------------------W 184

  Fly   319 KRLTPIIRTLFIGMAALQLLWDIMLVGTMLYYHRMIEKVISGIIAILTWYFTYRFWY--P-TPGL 380
            .|:.  |...|..::.|.::|..|.:.|.:|:|.:.:|||.....||.||.|||:||  | :|||
 Frog   185 HRMA--INAQFAALSILVIIWVWMFLCTAVYFHNIFQKVIGTAFGILAWYITYRWWYLKPISPGL 247

  Fly   381 LPEAPGNGSFSYQREIPTF 399
            .|     .|.|:..:.|.:
 Frog   248 PP-----ASASHSGKEPIY 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FitmNP_729053.2 Scs3p 157..371 CDD:287263 64/220 (29%)
fitm2XP_012826930.2 Scs3p 50..235 CDD:402051 65/222 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 87 1.000 Domainoid score I7877
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H35254
Inparanoid 1 1.050 130 1.000 Inparanoid score I4512
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621925at2759
OrthoFinder 1 1.000 - - FOG0001836
OrthoInspector 1 1.000 - - otm47689
Panther 1 1.100 - - LDO PTHR23129
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1295
SonicParanoid 1 1.000 - - X5529
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.100

Return to query results.
Submit another query.