DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlaRS-m and Cdc23

DIOPT Version :9

Sequence 1:NP_523932.2 Gene:AlaRS-m / 38595 FlyBaseID:FBgn0028962 Length:1012 Species:Drosophila melanogaster
Sequence 2:NP_848124.1 Gene:Cdc23 / 52563 MGIID:1098815 Length:597 Species:Mus musculus


Alignment Length:385 Identity:63/385 - (16%)
Similarity:128/385 - (33%) Gaps:140/385 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 LGEAYPEMAAKQQAVIDLICHEQEVYKNLRE----SSSKAFAEVLMEFPNLDDIDLMECPGFVPA 421
            |...|.|:...::|:        :.|::|.:    .||...:::.:.:.|:.|||..     :..
Mouse   234 LAHIYTELQLIEEAL--------QKYQHLIDVGFSKSSYIVSQIAVAYHNIRDIDKA-----LSI 285

  Fly   422 YRELQMQRCKFSNNTIPGDFLYKLTDTYGLTE-ESFLKLAELENMN----------CDLERYRAE 475
            :.||:.|                  |.|.:.. ::|..|..:.:|.          |::::||.|
Mouse   286 FNELRKQ------------------DPYRIENMDTFSNLLYVRSMKSELSYLAHNLCEIDKYRVE 332

  Fly   476 VSLAKLKAKGNQRETAGGSLCDLATEQRIAEAQAMLTKRLTP------TDNSHKYTYSFDKESDS 534
            .....            |:...|.::...|........:|.|      |...|:|   .:.::.|
Mouse   333 TCCVI------------GNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEY---MEMKNTS 382

  Fly   535 YQIPPLKTRVLGMLLNDAEVSRTQ-------GSR---IQQPFTDLISIVTAGSNFYYESGGQ-QS 588
            ..|...:..:        ||::..       |..   ::.||..|         :||....| :.
Mouse   383 AAIQAYRHAI--------EVNKRDYRAWYGLGQTYEILKMPFYCL---------YYYRRAHQLRP 430

  Fly   589 DGGKILVSNHQQPDHPHSLDVIGVKHLNDCVVHICKLSSPTDAF--QLAIGDEVELQV------- 644
            :..::||:                  |.:|...:.:|......:  ..|:||..::.:       
Mouse   431 NDSRMLVA------------------LGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLH 477

  Fly   645 ----DAQQ---------RQLNTCHHTATHL-LNAAIRSL----FKKVTYQVSSSVSSDQC 686
                :::|         :.:.:|..|..|| .:.|.|.|    ||...:..:|:.:...|
Mouse   478 EQLTESEQAAQCYIKYIQDIYSCGETVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCC 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlaRS-mNP_523932.2 PLN02900 13..1010 CDD:215487 63/385 (16%)
AlaRS_core 14..261 CDD:238360
tRNA_SAD 570..>667 CDD:298782 17/120 (14%)
tRNA_SAD 748..>784 CDD:197931
Cdc23NP_848124.1 TPR 1 27..63
ANAPC8 28..154 CDD:281973
TPR 2 73..112
TPR 3 114..144
TPR 4 169..200
TPR repeat 172..197 CDD:276809
TPR repeat 202..257 CDD:276809 6/30 (20%)
TPR <212..399 CDD:223533 36/218 (17%)
TPR 5 229..259 6/32 (19%)
TPR 6 263..293 8/52 (15%)
TPR repeat 263..291 CDD:276809 7/32 (22%)
TPR 7 297..327 4/29 (14%)
TPR_1 331..364 CDD:278916 6/44 (14%)
TPR 8 331..361 4/41 (10%)
TPR repeat 331..359 CDD:276809 4/39 (10%)
TPR 9 366..395 6/39 (15%)
TPR_11 367..430 CDD:290150 14/82 (17%)
TPR_1 367..398 CDD:278916 7/41 (17%)
TPR repeat 367..393 CDD:276809 5/36 (14%)
TPR repeat 398..428 CDD:276809 6/38 (16%)
TPR 10 400..432 7/40 (18%)
TPR 11 433..466 8/50 (16%)
TPR repeat 433..461 CDD:276809 5/45 (11%)
TPR repeat 467..495 CDD:276809 1/27 (4%)
TPR 12 468..500 1/31 (3%)
TPR repeat 501..536 CDD:276809 9/34 (26%)
TPR 13 504..540 9/34 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0013
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.