DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlaRS-m and CG10802

DIOPT Version :9

Sequence 1:NP_523932.2 Gene:AlaRS-m / 38595 FlyBaseID:FBgn0028962 Length:1012 Species:Drosophila melanogaster
Sequence 2:NP_570062.1 Gene:CG10802 / 31318 FlyBaseID:FBgn0029664 Length:436 Species:Drosophila melanogaster


Alignment Length:404 Identity:94/404 - (23%)
Similarity:152/404 - (37%) Gaps:72/404 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   528 FDKESDSYQIPPLKTRV-------LGMLLNDAEVSRTQGSRIQQPFTDLISIVTAGSNFYYESGG 585
            |..:.||: :...||::       |.......:|.:.:|          .:::...:..:.|.||
  Fly     3 FKCQEDSF-LKEFKTKIVSSEFATLDWTDPSGKVEKLKG----------FNVICEDTILFPEGGG 56

  Fly   586 QQSDGGKILVSNHQQPDHPHSLDVIGVKHLNDCVVHICKLSSPTDAFQLAIGDEVELQVDAQQRQ 650
            |..|.|.:           ....|..|:......||.  :.|||...|.|   ||.|.:|.|:|.
  Fly    57 QPCDYGTL-----------GGFPVKNVQRKGSTAVHF--VESPTSFEQDA---EVLLTLDYQRRL 105

  Fly   651 LNTCHHTATHLLNAAIRSLFK--KVTYQVSSSVSSDQCKLELGLLGKRIQKTDVQLIEDLINRVI 713
            .:...|:..||:.|.....||  ..::.:.|:||..|....     ..|.:..:.|||...|.:|
  Fly   106 DHMQQHSGQHLITALFDREFKYDTTSWSLGSTVSYIQLSTP-----HLISRESLDLIERQANDLI 165

  Fly   714 CSAAPVEVQLLSAAEVLEQNDITMVPGEVYPEQGL-RLVNVESPELQLSSKELCCGTHATNTSEL 777
            .....|.|.|:......|..|.....|.....:|| |:|.:|..|     ..:|||||.||.|:|
  Fly   166 REGREVTVLLVDPEVAQEFQDARAPRGLPKDHEGLARVVRIEGIE-----SNMCCGTHVTNLSQL 225

  Fly   778 SCFCIVNLKQTNRARFAFTAVAGQAAENVLKTAALLRHRVDLLEKQFQTDKLTNATEAELQTIRH 842
            .|..::..::. :|......|.|   |.||.....:..|    |:|. |..|.......|:.:: 
  Fly   226 QCIKLLYAEKV-KANVLVHFVVG---ERVLVKLGEVFQR----EQQL-TQALKGGPGQHLELVQ- 280

  Fly   843 NMLHTDIKLPYAFKMDTLER-ITEMLKRIKDSSRTTLKEFVDVEMR---------TLLQEKPLDT 897
             .|..::|....:....|:| .|...:|:.|..:....::..:..|         |.|:..|   
  Fly   281 -KLQQNVKGSRKYFQQLLKRYATAEAERLCDLPKKDRPKYFSLHRRDGIEVDFINTFLRAAP--- 341

  Fly   898 HPFILHYITSSALV 911
             ..|.:::|.|..|
  Fly   342 -EGIFYFLTVSESV 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlaRS-mNP_523932.2 PLN02900 13..1010 CDD:215487 94/404 (23%)
AlaRS_core 14..261 CDD:238360
tRNA_SAD 570..>667 CDD:298782 25/96 (26%)
tRNA_SAD 748..>784 CDD:197931 15/36 (42%)
CG10802NP_570062.1 AlaX 6..250 CDD:225427 70/284 (25%)
tRNA_SAD 43..229 CDD:298782 59/211 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464490
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.