DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlaRS-m and LOC100536819

DIOPT Version :9

Sequence 1:NP_523932.2 Gene:AlaRS-m / 38595 FlyBaseID:FBgn0028962 Length:1012 Species:Drosophila melanogaster
Sequence 2:XP_003201135.2 Gene:LOC100536819 / 100536819 -ID:- Length:362 Species:Danio rerio


Alignment Length:171 Identity:36/171 - (21%)
Similarity:55/171 - (32%) Gaps:58/171 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   525 TYSFDKESDSY-QIPPLKTRVL-----------GMLLNDAEVSRTQGSRIQQPFTDLISIVTAGS 577
            |:|...:||.| .:..|.|.:|           |.|:.|..|.|.:.||                
Zfish   208 TFSMKVDSDMYINLENLMTLLLRPELPRQNYITGFLMWDRPVIRNKKSR---------------- 256

  Fly   578 NFYYESGGQQSDGGKILVSNHQQPDHPHSLDVIGVKHL--NDCVVHICKLSSPTDAFQL------ 634
              ||             ||....||..:...|:||.::  ||....:.:.|.....|.:      
Zfish   257 --YY-------------VSEELYPDTKYPTYVLGVAYVFSNDLPKKLVEASKDVAPFNIEDAYIG 306

  Fly   635 ----AIGDEVELQVDAQQRQL---NTCHHTATHLLNAAIRS 668
                .||.:.....|..|.:.   :..||..:.::....||
Zfish   307 ACLKQIGVKPSRSPDPSQFRTYMKDPKHHDLSKVITTIARS 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlaRS-mNP_523932.2 PLN02900 13..1010 CDD:215487 36/171 (21%)
AlaRS_core 14..261 CDD:238360
tRNA_SAD 570..>667 CDD:298782 19/111 (17%)
tRNA_SAD 748..>784 CDD:197931
LOC100536819XP_003201135.2 Galactosyl_T 126..316 CDD:328824 30/138 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576702
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.