DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlaRS-m and LOC100535229

DIOPT Version :9

Sequence 1:NP_523932.2 Gene:AlaRS-m / 38595 FlyBaseID:FBgn0028962 Length:1012 Species:Drosophila melanogaster
Sequence 2:XP_021323630.1 Gene:LOC100535229 / 100535229 -ID:- Length:257 Species:Danio rerio


Alignment Length:221 Identity:94/221 - (42%)
Similarity:121/221 - (54%) Gaps:33/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 SRILPFGCADNFWEMGATGPCGPCTEIHIDHRPDLGSVEQRAKLVNAGRSDLTELWNLVFIQYNR 231
            |||||....|||||||.|||||||:|||.|.   :|. ...|.||:....::.|:|||||||:||
Zfish     4 SRILPGSMKDNFWEMGDTGPCGPCSEIHYDR---IGG-RDAAHLVSMNDPNVLEIWNLVFIQFNR 64

  Fly   232 HADGSISQLPAHHVDTGMGFERLTAVLQNKSSNYDTDLFTPIFDGIQQAAKTPVYSGSF----PD 292
            .::..:..||...:|||||.|||.:|||||.||||||||.|.|:.||:......|:|..    .|
Zfish    65 ESETVLKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARAYTGKVGAEDTD 129

  Fly   293 GGNAAVLDTSYRILADHARMVTACLADGMLPDQNQKLRRVLRKALNISEHVFAHDKLLTQLVPIV 357
            |     :|.:||:||||||.:|..|.||..||...:           ..||        .|: :.
Zfish   130 G-----IDMAYRVLADHARTITIALYDGGRPDNTGR-----------GSHV--------HLI-VY 169

  Fly   358 VETLGEAYPEMAAKQQAVIDLICHEQ 383
            ....|:|:||:......|.|:|..|:
Zfish   170 CSFQGDAFPELRKDPDMVKDIINEEE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlaRS-mNP_523932.2 PLN02900 13..1010 CDD:215487 94/221 (43%)
AlaRS_core 14..261 CDD:238360 50/93 (54%)
tRNA_SAD 570..>667 CDD:298782
tRNA_SAD 748..>784 CDD:197931
LOC100535229XP_021323630.1 tRNA-synt_2c 3..>221 CDD:332954 94/221 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D129373at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.