DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gen and AT5G26680

DIOPT Version :9

Sequence 1:NP_647943.2 Gene:Gen / 38594 FlyBaseID:FBgn0263831 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_850877.2 Gene:AT5G26680 / 832721 AraportID:AT5G26680 Length:453 Species:Arabidopsis thaliana


Alignment Length:415 Identity:103/415 - (24%)
Similarity:167/415 - (40%) Gaps:92/415 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVKELWGVL---TPHC-ERKPINELRGKKVAIDLAGWVCESLNVVDYFV--------------- 46
            ||:|.|..:|   .|.| :.:......|:|:|:|      .|:::..:.:               
plant     1 MGIKGLTKLLADNAPSCMKEQKFESYFGRKIAVD------ASMSIYQFLIVVGRTGTEMLTNEAG 59

  Fly    47 HPRHHLKNLFFRTCYLIWEQVTPVFVLEGVAPKLKSQVIAKRNE------LQFRGVKPKNSPECT 105
            ....||:.:|.||..|:...:.||:|.:|..|:||.|.:|||..      ....|.....:.|..
plant    60 EVTSHLQGMFNRTIRLLEAGIKPVYVFDGKPPELKRQELAKRYSKRADATADLTGAIEAGNKEDI 124

  Fly   106 QSQPSKGDKGRSRFNHVLKQCETLLLSMGIQCVQGPGEAEAYCAFLNKHGLVDGVISQDSDCFAY 170
            :....:..|...:.|   ..|:.||..||:..|:...||||.||.|.|.|.|.||.|:|.|...:
plant   125 EKYSKRTVKVTKQHN---DDCKRLLRLMGVPVVEATSEAEAQCAALCKSGKVYGVASEDMDSLTF 186

  Fly   171 GAVRVYRNFSVSTQGAQAAAGGAVDI--YDMREITSRMDFGQQKIIVMALLCGCDYCPDGIGGIG 233
            ||.:..|:.       ...:...:.:  :::.:|...:.....:.|.:.:|.||||| |.|.|||
plant   187 GAPKFLRHL-------MDPSSRKIPVMEFEVAKILEELQLTMDQFIDLCILSGCDYC-DSIRGIG 243

  Fly   234 KDGVLKLFNKYKETE-ILDRMRSWRGETDK---YN----------------ALEIR---VDDKSI 275
            ....|||..::...| ||:.:...|.:..:   ||                .|:|:   .|::.|
plant   244 GQTALKLIRQHGSIETILENLNKERYQIPEEWPYNEARKLFKEPDVITDEEQLDIKWTSPDEEGI 308

  Fly   276 CS--------NCGHIGKTQSHTKSGCSVCRTHKGCDESLWKEQRLSIKSELTLRRKALLSPDFPN 332
            ..        |...:.|.....|:..:  ::.:|..||.:|.   ...|.:..:||.        
plant   309 VQFLVNENGFNIDRVTKAIEKIKTAKN--KSSQGRLESFFKP---VANSSVPAKRKG-------- 360

  Fly   333 EEIIAEFLSEPDTIPNLNLNWRQPN 357
             .:|....||  .|||: |:.|.||
plant   361 -NLICLVASE--VIPNI-LDHRVPN 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GenNP_647943.2 PIN_GEN1 1..385 CDD:189039 103/415 (25%)
H3TH_GEN1 210..342 CDD:188625 36/162 (22%)
AT5G26680NP_850877.2 PTZ00217 1..359 CDD:240317 91/379 (24%)
PIN_FEN1 4..346 CDD:189037 87/360 (24%)
H3TH_FEN1-Euk 222..290 CDD:188627 21/68 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0258
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094524at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.