DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gen and ercc5

DIOPT Version :9

Sequence 1:NP_647943.2 Gene:Gen / 38594 FlyBaseID:FBgn0263831 Length:726 Species:Drosophila melanogaster
Sequence 2:XP_003197653.2 Gene:ercc5 / 541502 ZFINID:ZDB-GENE-050327-28 Length:1010 Species:Danio rerio


Alignment Length:463 Identity:92/463 - (19%)
Similarity:177/463 - (38%) Gaps:90/463 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EQVTPVFVLEGVAPKLKSQVIAKRNELQFRGVKPKNSPECTQSQPSKGDKGRSRF-NHVLKQCET 128
            :|:..|......||.:.........|||....:.::..:..:.|..:..:..|.. ..:.::.:.
Zfish   600 DQIEDVDESVNEAPAVSEWEHIDTEELQLLDRELQDEQQTLREQHQQQQRSSSTVTGQMCQESQE 664

  Fly   129 LLLSMGIQCVQGPGEAEAYCAFLNKHGLVDGVISQDSDCFAYGAVRVYRNFSVSTQGAQAAAGGA 193
            ||...|:..:..|.||||.||.|::.....|.|:.|||.:.:|...|||||....:        .
Zfish   665 LLRLFGVPFIVAPMEAEAQCAALDRLDQTHGTITDDSDIWLFGGRHVYRNFFNQNK--------Y 721

  Fly   194 VDIYDMREITSRMDFGQQKIIVMALLCGCDYCPDGIGGIGKDGVLKLFNKYKET--EILDRMRSW 256
            |:.|.:.::.:::...:.|:|.:|.|.|.|| .:||.|:|....:::.|::...  |.|.::..|
Zfish   722 VEHYQIVDMQNQLGLDRSKLINLAYLLGSDY-TEGIPGVGYVTGMEILNEFPGAGLEPLVQLSEW 785

  Fly   257 RGETDKYNALEIRVDDKSICSNCGHIGKTQSHTKSGCSVCRTHKGCDESLWKEQRLSIKSELTLR 321
            ..|..:...|.:...|                ||                       :|.:|   
Zfish   786 WTEAQENKKLSVNPKD----------------TK-----------------------VKKKL--- 808

  Fly   322 RKALLSPDFPNEEIIAEFLSEPDTIPNLNLNWRQPNLVKFIKQIGHLLQWPEIYCFQKF------ 380
            |...:.|.|||..:...:|.......:.:.:|.:|:| ..||:          :|..:|      
Zfish   809 RNLQIHPGFPNPAVAQAYLQPSVDQSDASFSWGRPHL-DLIKE----------FCQSRFGWSSRK 862

  Fly   381 -----FPILTRWQVQQSKQEKILIQPHEIIKKRTVKGVPSLELRWHDPSGIFKGLIPDKQIAEYE 440
                 .|:|.:   .||:|.::.|.....::::..:.:.|..||        :.:|..|:....|
Zfish   863 TEETLQPVLKQ---LQSQQTQLRIDSFFRLEQQDRQQIRSERLR--------RAVICMKRKEREE 916

  Fly   441 AEHPKGIEELYYTIEPLDMLETAYPDLVAAFLKSKEKPAKKTTRKKKTASEEENKENEPNSKPKR 505
            .|..:.:..........|  |...| |...|:.|..:.:.:....|:..:|..:..:|..::..:
Zfish   917 EEEDESVSAQKQGRSEAD--EAPGP-LAGGFISSDPQTSTQGGGAKQIRAESSSSSSEEEAESGK 978

  Fly   506 VVRKIKAQ 513
            .|..:.|:
Zfish   979 GVAMVTAR 986

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GenNP_647943.2 PIN_GEN1 1..385 CDD:189039 69/333 (21%)
H3TH_GEN1 210..342 CDD:188625 28/133 (21%)
ercc5XP_003197653.2 rad2 1..909 CDD:273166 78/381 (20%)
PIN_XPG 1..>120 CDD:189038
PIN_SF <626..872 CDD:301351 64/307 (21%)
H3TH_XPG 740..832 CDD:188624 28/134 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0258
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094524at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.