DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gen and ERCC5

DIOPT Version :9

Sequence 1:NP_647943.2 Gene:Gen / 38594 FlyBaseID:FBgn0263831 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_000114.3 Gene:ERCC5 / 2073 HGNCID:3437 Length:1186 Species:Homo sapiens


Alignment Length:455 Identity:96/455 - (21%)
Similarity:167/455 - (36%) Gaps:124/455 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 WEQVTPVFVLEGVAPKLKSQVIAKRNELQFRGVKPKNSPECTQSQPSKGDKGRSRFNHVLKQCET 128
            |:.:.    ||.: ..|:|.::|::|.|:.:..:.:........|             :..:.:.
Human   728 WQDIN----LEEL-ETLESNLLAQQNSLKAQKQQQERIAATVTGQ-------------MFLESQE 774

  Fly   129 LLLSMGIQCVQGPGEAEAYCAFLNKHGLVDGVISQDSDCFAYGAVRVYRNFSVSTQGAQAAAGGA 193
            ||...||..:|.|.||||.||.|:......|.|:.|||.:.:||..|||||....:        .
Human   775 LLRLFGIPYIQAPMEAEAQCAILDLTDQTSGTITDDSDIWLFGARHVYRNFFNKNK--------F 831

  Fly   194 VDIYDMREITSRMDFGQQKIIVMALLCGCDYCPDGIGGIGKDGVLKLFNKY--KETEILDRMRSW 256
            |:.|...:..:::...:.|:|.:|.|.|.|| .:||..:|....:::.|::  ...|.|.:...|
Human   832 VEYYQYVDFHNQLGLDRNKLINLAYLLGSDY-TEGIPTVGCVTAMEILNEFPGHGLEPLLKFSEW 895

  Fly   257 RGETDKYNALEIRVDDKSICSNCGHIGKTQSHTKSGCSVCRTHKGCDESLWKEQRLSIKSELTLR 321
            ..|..|...:.....|                ||                       :|.:|   
Human   896 WHEAQKNPKIRPNPHD----------------TK-----------------------VKKKL--- 918

  Fly   322 RKALLSPDFPNEEIIAEFLSEPDTIPNLNLNWRQPNLVKFIKQIGHLLQWPEIYCFQKFFPILTR 386
            |...|:|.|||..:...:|.........:..|.:|:|.|..:.......|......:..||:|.:
Human   919 RTLQLTPGFPNPAVAEAYLKPVVDDSKGSFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPVLKQ 983

  Fly   387 WQVQQ-----------SKQEKILIQPHEIIKKRTVKGVPSLELRWHDPSGIFKGLIPDKQIAEYE 440
            ...||           ::|||   :..:.||.:.:....:..||            .:|:.|..|
Human   984 LDAQQTQLRIDSFFRLAQQEK---EDAKRIKSQRLNRAVTCMLR------------KEKEAAASE 1033

  Fly   441 AEHPKGIEELYYTIE-PLDMLETAYPDLVAAFLKSKEKPAKK---------TTRKKKTASEEENK 495
                  ||.:...:| ..::|:           |:|.|..|:         ::.|:|..|:.:.|
Human  1034 ------IEAVSVAMEKEFELLD-----------KAKGKTQKRGITNTLEESSSLKRKRLSDSKGK 1081

  Fly   496  495
            Human  1082  1081

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GenNP_647943.2 PIN_GEN1 1..385 CDD:189039 71/322 (22%)
H3TH_GEN1 210..342 CDD:188625 28/133 (21%)
ERCC5NP_000114.3 rad2 1..1029 CDD:273166 82/384 (21%)
N-domain. /evidence=ECO:0000305|PubMed:32522879 1..78
DNA-binding, may bind to the undamaged single-strand DNA of the DNA repair bubble. /evidence=ECO:0000269|PubMed:32821917, ECO:0000312|PDB:6TUW, ECO:0007744|PDB:6TUX 31..67
Spacer region. /evidence=ECO:0000269|PubMed:16246722 79..785 13/74 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..342
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..385
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 404..473
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 510..533
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 667..724
I-domain. /evidence=ECO:0000305|PubMed:32522879 786..881 33/103 (32%)
DNA-binding, may bind to the undamaged single-strand DNA of the DNA repair bubble. /evidence=ECO:0000269|PubMed:32821917, ECO:0000312|PDB:6TUW, ECO:0007744|PDB:6TUX 820..836 6/23 (26%)
DNA-binding, H2TH (helix-2turn-helix) motif which binds double-stranded DNA. /evidence=ECO:0000269|PubMed:32821917, ECO:0000312|PDB:6TUW, ECO:0007744|PDB:6TUX 848..880 10/32 (31%)
DNA-binding, may bind double-stranded DNA. /evidence=ECO:0000269|PubMed:32821917, ECO:0000312|PDB:6TUW, ECO:0007744|PDB:6TUX 912..918 3/28 (11%)
Interaction with PCNA. /evidence=ECO:0000269|PubMed:9305916 981..1009 6/30 (20%)
Interaction with ERCC6/CSB. /evidence=ECO:0000269|PubMed:16246722 1011..1186 18/100 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1056..1081 4/24 (17%)
Nuclear localization signal 1. /evidence=ECO:0000305|PubMed:26812207 1057..1074 2/16 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1095..1186
Nuclear localization signal 2. /evidence=ECO:0000305|PubMed:26812207 1169..1186
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094524at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.