DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gen and Fen1

DIOPT Version :9

Sequence 1:NP_647943.2 Gene:Gen / 38594 FlyBaseID:FBgn0263831 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_001258543.1 Gene:Fen1 / 14156 MGIID:102779 Length:380 Species:Mus musculus


Alignment Length:389 Identity:96/389 - (24%)
Similarity:160/389 - (41%) Gaps:111/389 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GVKELWGVLTPHCERKPINELR---GKKVAIDLAGWVCESLNVVDYFVHPRH------------- 50
            |:.:|...:.|...|:  |:::   |:|||||      .|:::..:.:..|.             
Mouse     5 GLAKLIADVAPSAIRE--NDIKSYFGRKVAID------ASMSIYQFLIAVRQGGDVLQNEEGETT 61

  Fly    51 -HLKNLFFRTCYLIWEQVTPVFVLEGVAPKLKSQVIAKRNELQFRGVKPKNSPECTQSQPS---- 110
             ||..:|:||..::...:.||:|.:|..|:|||..:|||:|.:....|     :..|:|.:    
Mouse    62 SHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEK-----QLQQAQEAGMEE 121

  Fly   111 KGDKGRSRFNHVLKQ----CETLLLSMGIQCVQGPGEAEAYCAFLNKHGLVDGVISQDSDCFAYG 171
            :.:|...|...|.||    |:.||..|||..:..|.||||.||.|.|.|.|....::|.||..:|
Mouse   122 EVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALAKAGKVYAAATEDMDCLTFG 186

  Fly   172 AVRVYRNFSVSTQGAQAAAGGAVDIYDMREITSRMDFGQQKIIVMALLCGCDYCPDGIGGIGKDG 236
            :..:.|:.:     |..|....:..:.:..:...:...|::.:.:.:|.|.||| :.|.|||...
Mouse   187 SPVLMRHLT-----ASEAKKLPIQEFHLSRVLQELGLNQEQFVDLCILLGSDYC-ESIRGIGPKR 245

  Fly   237 VLKLFNKYKETEILDRMRSWRGETDKYNALEIRVDDKSICSNCGHIGKTQSHTKSGCSVCRTHKG 301
            .:.|..|:|..|.:.|    |.:..||...|..:                            || 
Mouse   246 AVDLIQKHKSIEEIVR----RLDPSKYPVPENWL----------------------------HK- 277

  Fly   302 CDESLWKEQRLSIKSELTLRRKALLSPDFPNEEIIAEFLSEPDTIPNLNLNWRQPN---LVKFI 362
                  :.|:|.::.|       :|.|:                  ::.|.|.:||   ||||:
Mouse   278 ------EAQQLFLEPE-------VLDPE------------------SVELKWSEPNEEELVKFM 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GenNP_647943.2 PIN_GEN1 1..385 CDD:189039 96/389 (25%)
H3TH_GEN1 210..342 CDD:188625 26/131 (20%)
Fen1NP_001258543.1 PTZ00217 1..359 CDD:240317 96/389 (25%)
I-domain 122..253 40/136 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..380
Interaction with PCNA. /evidence=ECO:0000255|HAMAP-Rule:MF_03140 336..344
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094524at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.