DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srp54k and CID9

DIOPT Version :9

Sequence 1:NP_523931.1 Gene:Srp54k / 38593 FlyBaseID:FBgn0010747 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_188063.1 Gene:CID9 / 820668 AraportID:AT3G14450 Length:327 Species:Arabidopsis thaliana


Alignment Length:177 Identity:36/177 - (20%)
Similarity:62/177 - (35%) Gaps:37/177 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KLVDPGVKPYQPIKGKANVVMFVGLQGSGKTTTCTKLAYHYQKRNWKSCLVCADTFRAGAYDQVK 149
            |::|.|::       |:::.       ..||.|.::|..|.....:|.....|..|....||..|
plant    26 KIIDEGIE-------KSSIT-------DSKTETESRLDMHKLVAMFKKLNPLAKEFFPSYYDPKK 76

  Fly   150 QNATKARIPFYGSYTEIDPVVIAQDGVDMFKREGFEMIIVDT----SGRHKQEESLFEEMLA--V 208
            .|.......|           :..|..:..|::..|...:|.    :.|.::..|.....|.  :
plant    77 NNQVAKANQF-----------LPADDFETTKKQSGEEFDLDAKKDDNTRKRRNYSQGRRRLTGRI 130

  Fly   209 SNAVSPDNI---IFVMDATIGQACEAQAKAFKDKVDIGSVIITKLDG 252
            |.|...|:|   ::|.|.......|..|..|.   :.|.|:..::.|
plant   131 SKAQREDSIRRTVYVSDIDQSVTEEGLAGLFS---NCGQVVDCRICG 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srp54kNP_523931.1 SRP54_euk 2..428 CDD:273615 36/177 (20%)
SRP54_N 6..83 CDD:280954
SRP54 102..294 CDD:278855 32/160 (20%)
SRP_SPB 327..428 CDD:281039
CID9NP_188063.1 PAM2 55..72 CDD:284542 3/16 (19%)
RRM1_CID8_like 139..218 CDD:240905 9/39 (23%)
RRM2_CID8_like 234..315 CDD:240906
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.